SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.08g197200

Feature Type:gene_model
Chromosome:Gm08
Start:15908698
stop:15910864
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.08g197200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G51760.1AT peptidase M20/M25/M40 family protein JGI N/AIEA
GO:0008152GO-bp metabolic process EnsemblGenomesN/AIEA
GO:0008152GO-bp metabolic process JGI N/AIEA
GO:0016787GO-mf hydrolase activity EnsemblGenomesN/AIEA
GO:0016787GO-mf hydrolase activity JGI N/AIEA
PTHR11014Panther PEPTIDASE M20 FAMILY MEMBER JGI N/AIEA
PTHR11014:SF41Panther JGI N/AIEA
PF01546PFAM Peptidase family M20/M25/M40 JGI N/AIEA
PF07687PFAM Peptidase dimerisation domain JGI N/AIEA
PWY-1822SoyCyc9 indole-3-acetate activation I Plant Metabolic Network ISS
PWY-6235SoyCyc9 hydroxyjasmonate sulfate biosynthesis Plant Metabolic Network ISS
GN7V-55777SoyCyc9-rxn Enzyme name not determined Plant Metabolic Network ISS

Expression Patterns of Glyma.08g197200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.08g197200 not represented in the dataset
Glyma.08g197200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.08g197200
ParalogEvidenceComments
Glyma.07g013100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.08g197200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma08g21065 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.08g197200
>Glyma.08g197200.1 sequence-type=CDS polypeptide=Glyma.08g197200.1.p locus=Glyma.08g197200 ID=Glyma.08g197200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATCCTTTTCCAACCAGCAGAGGAAGGAGGTGCAAGGGCTAAGAAAATTTTAGATGCTGGAGCCTTAGATAATGTTATTGCTATTTTTGGATTACATGTGAAGCCTGAGATTCCTATAGGAAGTGGTGTATTTGAAGCAATAATAAGAGGAAAGGGAGGTCATGCAGCTCTTCCTCAACTTTCTATAGACCCTGTAATGGCAGCTACCAATGGCATTATTAGCTTACAAAACCTTGTTTCTCGCAAGGCTGGTCCTCTTGACCCCCAGGTTTTGACAGTTGCAAAGCTCCAAGGAGGTGCTGCATTCGATGTTATTCCAGATTATGTCATAATTGGTGGCACCTTCCGAGCTCTTTCTAGAGAAGCATTGAAGCACCTTAAACAGCGCATTGAGCAGGTTATCATTGGTCAAGCAGCTGTGCTGAGGTGCAATGCAAGTGTCAATTTCCTTGATGAAGAGAAACCTTTATATCCTCCAACTATAAAGAATGATGACTTGCACAAGGTTTTTGTTGATGTAGCTGGGAATTTGATTGGTATTTATAATGTTAACATTGATATGCAAACAGACATGGCAGCTGAAGACTTTGCATTCTATCAAGAGGCCATACCTGGCTATTACTTCACGCTTGGAATGAAGAATGCTTCTTCAATTGAAACGGTTGCGCCATTACACTCACCCTATCTTGTAATCAATGAAGATGGACTTCCCTATGGGGCTGCACTTCATGCATCATTGGCCACTGATTATCTTACAAAATATAAACAGGACGTAGCCAGGGTAGTCGGGAAATATCATGGTCAACTATGA
Predicted protein sequences of Glyma.08g197200
>Glyma.08g197200.1.p sequence-type=predicted peptide transcript=Glyma.08g197200.1 locus=Glyma.08g197200 ID=Glyma.08g197200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MILFQPAEEGGARAKKILDAGALDNVIAIFGLHVKPEIPIGSGVFEAIIRGKGGHAALPQLSIDPVMAATNGIISLQNLVSRKAGPLDPQVLTVAKLQGGAAFDVIPDYVIIGGTFRALSREALKHLKQRIEQVIIGQAAVLRCNASVNFLDEEKPLYPPTIKNDDLHKVFVDVAGNLIGIYNVNIDMQTDMAAEDFAFYQEAIPGYYFTLGMKNASSIETVAPLHSPYLVINEDGLPYGAALHASLATDYLTKYKQDVARVVGKYHGQL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo