|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G60950.1 | AT | 2Fe-2S ferredoxin-like superfamily protein | JGI | N/A | IEA |
GO:0022900 | GO-bp | electron transport chain | EnsemblGenomes | N/A | IEA |
GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
GO:0009507 | GO-cc | chloroplast | EnsemblGenomes | N/A | IEA |
GO:0009536 | GO-cc | plastid | EnsemblGenomes | N/A | IEA |
GO:0009055 | GO-mf | electron transfer activity | EnsemblGenomes | N/A | IEA |
GO:0009055 | GO-mf | electron carrier activity | JGI | N/A | IEA |
GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
GO:0051536 | GO-mf | iron-sulfur cluster binding | EnsemblGenomes | N/A | IEA |
GO:0051536 | GO-mf | iron-sulfur cluster binding | JGI | N/A | IEA |
GO:0051537 | GO-mf | 2 iron, 2 sulfur cluster binding | EnsemblGenomes | N/A | IEA |
PF00111 | PFAM | 2Fe-2S iron-sulfur cluster binding domain | JGI | N/A | IEA |
Glyma.08g188500 not represented in the dataset |
Glyma.08g188500 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.12g169400 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma08g20111 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.08g188500.1 sequence-type=CDS polypeptide=Glyma.08g188500.1.p locus=Glyma.08g188500 ID=Glyma.08g188500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCGACCACAGCGGCGTTGTGTGGCACTATGTTGAACACCTCCTTCCTGAGGAGGCAGGCTTCAGTGAACATCACAAGCCTCAAGGCTAACGCTAACACTGTGTTTGGGAGGACGTGGAGGCGTGTGACTGCCATGGCAAGTTACAAGGTGAAGCTGATAACCCCAGAGGGAGAGCAAGAATTTGAATGCCCAGATGATGTATGCATTCTTGACCAGGCAGAGGAGAAAGGCCTTGAGCTTCCCTACTCATGCAGGGCTGGTTCTTGTTCTGTCTGTGCTGGCAAAGTGGAACAGTCAGATGGTAACTTCCTTGATGATGATCAAATTGTTGCAGGATTTGTTCTCACCCGTGTTGCTTACCCTACCTCAGACGTTGTCGTTGAGACTCACTGGGAGGAGGAGCTCACTGCTTAA
>Glyma.08g188500.1.p sequence-type=predicted peptide transcript=Glyma.08g188500.1 locus=Glyma.08g188500 ID=Glyma.08g188500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MATTAALCGTMLNTSFLRRQASVNITSLKANANTVFGRTWRRVTAMASYKVKLITPEGEQEFECPDDVCILDQAEEKGLELPYSCRAGSCSVCAGKVEQSDGNFLDDDQIVAGFVLTRVAYPTSDVVVETHWEEELTA*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||