SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.08g185600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.08g185600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.08g185600

Feature Type:gene_model
Chromosome:Gm08
Start:14868248
stop:14869420
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G06470.1AT GNS1/SUR4 membrane protein family JGI N/AIEA
GO:0019367GO-bp fatty acid elongation, saturated fatty acid EnsemblGenomesN/AIEA
GO:0030148GO-bp sphingolipid biosynthetic process EnsemblGenomesN/AIEA
GO:0034625GO-bp fatty acid elongation, monounsaturated fatty acid EnsemblGenomesN/AIEA
GO:0034626GO-bp fatty acid elongation, polyunsaturated fatty acid EnsemblGenomesN/AIEA
GO:0042761GO-bp very long-chain fatty acid biosynthetic process EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane JGI N/AIEA
GO:0030176GO-cc integral component of endoplasmic reticulum membrane EnsemblGenomesN/AIEA
GO:0009922GO-mf fatty acid elongase activity EnsemblGenomesN/AIEA
KOG3071 KOG Fatty acyl-CoA elongase/Polyunsaturated fatty acid specific elongation enzyme JGI N/AIEA
PTHR11157Panther FATTY ACID ACYL TRANSFERASE-RELATED JGI N/AIEA
PF01151PFAM GNS1/SUR4 family JGI N/AIEA
PWY-1121SoyCyc9 suberin monomers biosynthesis Plant Metabolic Network ISS
PWY-321SoyCyc9 cutin biosynthesis Plant Metabolic Network ISS
PWY-5080SoyCyc9 very long chain fatty acid biosynthesis I Plant Metabolic Network ISS
PWY-5136SoyCyc9 fatty acid β-oxidation II (peroxisome) Plant Metabolic Network ISS
PWY-5143SoyCyc9 long-chain fatty acid activation Plant Metabolic Network ISS
PWY-5147SoyCyc9 oleate biosynthesis I (plants) Plant Metabolic Network ISS
PWY-5156SoyCyc9 superpathway of fatty acid biosynthesis II (plant) Plant Metabolic Network ISS
PWY-561SoyCyc9 superpathway of glyoxylate cycle and fatty acid degradation Plant Metabolic Network ISS
PWY-5971SoyCyc9 palmitate biosynthesis II (bacteria and plants) Plant Metabolic Network ISS
PWY-5989SoyCyc9 stearate biosynthesis II (bacteria and plants) Plant Metabolic Network ISS
PWY-6733SoyCyc9 sporopollenin precursors biosynthesis Plant Metabolic Network ISS
PWY-6803SoyCyc9 phosphatidylcholine acyl editing Plant Metabolic Network ISS
GN7V-67257SoyCyc9-rxn Enzyme name not determined Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.08g185600 not represented in the dataset

Glyma.08g185600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma08g19790 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.08g185600.1 sequence-type=CDS polypeptide=Glyma.08g185600.1.p locus=Glyma.08g185600 ID=Glyma.08g185600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAGTTTGATGTCAGCACTGGAATGGTGGCTGGTATACCATCCCAGCATCCAGAAGTTCTCATGGAAGCCTCCTCACACCCCTTTCTCCTCCCCTCTCTTCCTTAGTCTCTCCATCCTCAGCTACCTCTCCCTCACCCTCCTCCTCACCCTCCTCCCTCTCCCACCCTTCCCACACCGCCTCCTGAAGCCCATCACCGCCCTCCACAACCTCCTCCTCCTCCTCCTCTCCCTCCTCATGCTCCTGGGCTGCTCCCTCACCCTCCTCATCCACACCCCTCACCTCCGCTGGGCCGTCTGCTTCCCACCCCACACCAATCCCACCGGGCCCCTCTTCTTCTGGGCCTACATCTTCTACCTCTCCAAAATCCTCGAATTCCTCGACACGCTCTTCATCGTCCTCTCCCGCTCCTTCCGACGCCTCTCCTTCCTCCACGTCTACCACCACGCCACCGTCCTCCTCATGTGCTACCTCTGGCTCCAAACCTCCCAATCCCTCTTCCCCGTCGCGCTCCTCACCAATGCCTCCGTCCACGTCATCATGTACGGTTACTACTTCCTCAGCGCCCTCGGCATCCGCCCCTCCTGGAAGCGCGCCGTCACCGACTGCCAGATCATCCAGTTCGTCTTCAGCTTCGCAATTTCGGGTCTCATGCTCCACTACCACTTCTCCGGATCCGGATGCTCCGGGATTTGGGGCTGGTGCTTCAATGCGGTTTTTAATGCCTCTCTCTTGGCCCTCTTTGTTGATTTTCATCTCAAGAGTTATGCTAAGAAACGCACTCTTAATAAGGACTCATGA

>Glyma.08g185600.1.p sequence-type=predicted peptide transcript=Glyma.08g185600.1 locus=Glyma.08g185600 ID=Glyma.08g185600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSLMSALEWWLVYHPSIQKFSWKPPHTPFSSPLFLSLSILSYLSLTLLLTLLPLPPFPHRLLKPITALHNLLLLLLSLLMLLGCSLTLLIHTPHLRWAVCFPPHTNPTGPLFFWAYIFYLSKILEFLDTLFIVLSRSFRRLSFLHVYHHATVLLMCYLWLQTSQSLFPVALLTNASVHVIMYGYYFLSALGIRPSWKRAVTDCQIIQFVFSFAISGLMLHYHFSGSGCSGIWGWCFNAVFNASLLALFVDFHLKSYAKKRTLNKDS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo