SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.08g151200

Feature Type:gene_model
Chromosome:Gm08
Start:11633377
stop:11633676
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.08g151200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G28050.2AT Cytidine/deoxycytidylate deaminase family protein JGI N/AIEA
GO:0002100GO-bp tRNA wobble adenosine to inosine editing EnsemblGenomesN/AIEA
GO:0009451GO-bp RNA modification EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0003824GO-mf catalytic activity EnsemblGenomesN/AIEA
GO:0008251GO-mf tRNA-specific adenosine deaminase activity EnsemblGenomesN/AIEA
GO:0008270GO-mf zinc ion binding JGI N/AIEA
GO:0016787GO-mf hydrolase activity JGI N/AIEA
GO:0047974GO-mf guanosine deaminase activity EnsemblGenomesN/AIEA
PTHR11079Panther CYTOSINE DEAMINASE JGI N/AIEA
PTHR11079:SF18Panther JGI N/AIEA
PF00383PFAM Cytidine and deoxycytidylate deaminase zinc-binding region JGI N/AIEA
P165-PWYSoyCyc9 superpathway of purines degradation in plants Plant Metabolic Network ISS
PWY-5044SoyCyc9 purine nucleotides degradation I (plants) Plant Metabolic Network ISS
PWY-6595SoyCyc9 superpathway of guanosine nucleotides degradation (plants) Plant Metabolic Network ISS
PWY-6606SoyCyc9 guanosine nucleotides degradation II Plant Metabolic Network ISS
GN7V-65038SoyCyc9-rxn guanine deaminase Plant Metabolic Network ISS

Expression Patterns of Glyma.08g151200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.08g151200 not represented in the dataset
Glyma.08g151200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.08g151200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma08g16057 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.08g151200
>Glyma.08g151200.1 sequence-type=CDS polypeptide=Glyma.08g151200.1.p locus=Glyma.08g151200 ID=Glyma.08g151200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
GCTTGCAAGAAGCTTAAGCAGATAGAACTTGCAGATTGTGAAATCTATGCTTCTTGTGAACCTTGCCCCATGTGCTTTGGTGCAATCCACCTTTCTCAAATTAAGTGGTTGGTTTATGGAGCGAAGGCTGACGCAGCAATTGCTATTGGGTTTCATGATTTCATTGCAGATGCACTGCGAGGTACTGGATTCTATCAGAAAGCAACATAG
Predicted protein sequences of Glyma.08g151200
>Glyma.08g151200.1.p sequence-type=predicted peptide transcript=Glyma.08g151200.1 locus=Glyma.08g151200 ID=Glyma.08g151200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ACKKLKQIELADCEIYASCEPCPMCFGAIHLSQIKWLVYGAKADAAIAIGFHDFIADALRGTGFYQKAT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo