SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.08g135500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.08g135500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.08g135500

Feature Type:gene_model
Chromosome:Gm08
Start:10379971
stop:10380886
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.08g135500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18260.1AT syntaxin of plants 112 JGI N/AIEA
GO:0006886GO-bp intracellular protein transport EnsemblGenomesN/AIEA
GO:0006887GO-bp exocytosis EnsemblGenomesN/AIEA
GO:0006906GO-bp vesicle fusion EnsemblGenomesN/AIEA
GO:0016192GO-bp vesicle-mediated transport EnsemblGenomesN/AIEA
GO:0048278GO-bp vesicle docking EnsemblGenomesN/AIEA
GO:0005886GO-cc plasma membrane EnsemblGenomesN/AIEA
GO:0012505GO-cc endomembrane system EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0031201GO-cc SNARE complex EnsemblGenomesN/AIEA
GO:0000149GO-mf SNARE binding EnsemblGenomesN/AIEA
GO:0005484GO-mf SNAP receptor activity EnsemblGenomesN/AIEA
GO:0005515GO-mf protein binding JGI N/AIEA
KOG0810 KOG SNARE protein Syntaxin 1 and related proteins JGI N/AIEA
PTHR19957Panther SYNTAXIN JGI N/AIEA
PTHR19957:SF26Panther JGI N/AIEA
PF05739PFAM SNARE domain JGI N/AIEA

Expression Patterns of Glyma.08g135500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.08g135500 not represented in the dataset
Glyma.08g135500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.08g135500
ParalogEvidenceComments
Glyma.05g178400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.08g135500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma08g14400 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.08g135500
>Glyma.08g135500.1 sequence-type=CDS polypeptide=Glyma.08g135500.1.p locus=Glyma.08g135500 ID=Glyma.08g135500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGACAAAATCGTTCCAAAGTTACGCTGAACTGAAGAAACAGGCTGAGAAGGACGACCTTGAAGACTCTCATGACATTGAAGCAGGGAAACTCGACAAACCCACGGAAGACCATAACCACCTCTCTCAGTTCTTCCAAGAAGTTGAAGCAATCAAGGTTGAAATAGAAGAGATCGCGAACCTCTTATTGGACCTTTTGCAACTGCACGAAGAAGACCGCATGGTGTCTGACATGGTTGCCTTGTTTTGCAAGGCAAGGATCATCAAGTCAAGGCTCGAGGTTATTGACCAATCCAACATAACCAATCGCACTTTATCAGAATCCTACATAGAAGTAACCCAAATAAGAATGTCTGTCACAAATGGTTTGAGGGCAAAACTTAGGGTCATGTTGATGCATGGATTTCAGTCCTTGAGAGACAAGTTTCTCATGGAGAAAATGATTTCGAGGAGTCTCAAAGTTGAGTTTATGGTTGCTGCAGCAGGGAAAACGGATATTGATAATGCTGATTTGGGTGTTAGGCATGAGGAAGTGATCATGGATATCCAGAGGAGTTTGAATATGCTTGACCAGATTTTTGTTGACATAGCTATTTTGGTTGAGACCCAAGGAGAAAACTTGGATAGCATTGAGGATCGTGTGGCCAGTGTTGTTAACAATGCTAACCAAATGAAGAGGAAGAACACCAACACAGAATGGCTCTGTTGGGTTCTTGTGGTGATGCTGCTGACTGTGTTTCTTTACTGGGGGAGAAATTTGGAGGGAGTGGTTTAG
Predicted protein sequences of Glyma.08g135500
>Glyma.08g135500.1.p sequence-type=predicted peptide transcript=Glyma.08g135500.1 locus=Glyma.08g135500 ID=Glyma.08g135500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MTKSFQSYAELKKQAEKDDLEDSHDIEAGKLDKPTEDHNHLSQFFQEVEAIKVEIEEIANLLLDLLQLHEEDRMVSDMVALFCKARIIKSRLEVIDQSNITNRTLSESYIEVTQIRMSVTNGLRAKLRVMLMHGFQSLRDKFLMEKMISRSLKVEFMVAAAGKTDIDNADLGVRHEEVIMDIQRSLNMLDQIFVDIAILVETQGENLDSIEDRVASVVNNANQMKRKNTNTEWLCWVLVVMLLTVFLYWGRNLEGVV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo