Report for Sequence Feature Glyma.08g095700
| Feature Type: | gene_model |
| Chromosome: | Gm08 |
| Start: | 7288871 |
| stop: | 7292274 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.08g095700
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT1G06515.2 | AT |
|
JGI | N/A | IEA |
| PTHR33727 | PantherFam |
OS07G0446900 PROTEIN |
JGI | N/A | IEA |
| PF11779 | Pfam |
Small subunit of serine palmitoyltransferase-like |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.08g095700 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma08g10130 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.08g095700
>Glyma.08g095700.1 sequence-type=CDS polypeptide=Glyma.08g095700.1.p locus=Glyma.08g095700 id=Glyma.08g095700.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAATTGGATTCAGCGCAAGATCTACCTTTACAATGTGACTTTTGGGCTGTATATGTTGGACTGGTGGGAGCGTTGTACCTTCAATATTGTGGTGATTATATTAATGTGTTTCGTTCTACGATACGTTACTCAGTTCTTCAAGAGGTATGTTTGGTAA
Predicted protein sequences of Glyma.08g095700
>Glyma.08g095700.1.p sequence-type=predicted peptide transcript=Glyma.08g095700.1 locus=Glyma.08g095700 id=Glyma.08g095700.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MNWIQRKIYLYNVTFGLYMLDWWERCTFNIVVIILMCFVLRYVTQFFKRYVW*