|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G02620.1 | AT | vacuolar ATPase subunit F family protein | JGI | N/A | IEA |
GO:0006811 | GO-bp | ion transport | EnsemblGenomes | N/A | IEA |
GO:0015991 | GO-bp | ATP hydrolysis coupled proton transport | EnsemblGenomes | N/A | IEA |
GO:0034220 | GO-bp | ion transmembrane transport | EnsemblGenomes | N/A | IEA |
GO:0034220 | GO-bp | ion transmembrane transport | JGI | N/A | IEA |
GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
GO:0033180 | GO-cc | proton-transporting V-type ATPase, V1 domain | EnsemblGenomes | N/A | IEA |
GO:0042625 | GO-mf | ATPase coupled ion transmembrane transporter activity | EnsemblGenomes | N/A | IEA |
GO:0046961 | GO-mf | proton-transporting ATPase activity, rotational mechanism | EnsemblGenomes | N/A | IEA |
KOG3432 | KOG | Vacuolar H+-ATPase V1 sector, subunit F | JGI | N/A | IEA |
PTHR13861 | Panther | VACUOLAR ATP SYNTHASE SUBUNIT F | JGI | N/A | IEA |
PF01990 | PFAM | ATP synthase (F/14-kDa) subunit | JGI | N/A | IEA |
PWY-7219 | SoyCyc9 | adenosine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
PWY-7229 | SoyCyc9 | superpathway of adenosine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
PWY-841 | SoyCyc9 | superpathway of purine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS |
Glyma.08g090500 not represented in the dataset |
Glyma.08g090500 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.05g135300 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma08g09571 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.08g090500.1 sequence-type=CDS polypeptide=Glyma.08g090500.1.p locus=Glyma.08g090500 ID=Glyma.08g090500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCCAACAGAGTTCAAATTCCTACCAACAATTCAGCCCTCATTGCTATGATTGCAGATGAGGATACTGTAGTTGGATTTCTGTTGGCTGGAGTGGGAAATGTTGACATACGTAGGAAGACAAATTACCTCATTGTGGATTCAAAAACAACTGTCAAACAAATTGAGGATGCATTCAAAGAATTTACAACAAGGGAGGATGTTGCAATTGTGCTGATTAGCCAATATGTTGCAAATATGATAAGGTTTTTGGTTGATAGCTATAACAAGCCTGTTCCTGCAATACTTGAAATCCCTTCTAAAGACCATCCTTATGATCCAGCACATGATTCAGTTCTGTCACGAGTGAAGTATCTCTTCAATACCGAATCAGTTGCATCTGGGAGACGCTGA
>Glyma.08g090500.1.p sequence-type=predicted peptide transcript=Glyma.08g090500.1 locus=Glyma.08g090500 ID=Glyma.08g090500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MANRVQIPTNNSALIAMIADEDTVVGFLLAGVGNVDIRRKTNYLIVDSKTTVKQIEDAFKEFTTREDVAIVLISQYVANMIRFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLFNTESVASGRR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||