Report for Sequence Feature Glyma.08g049600
| Feature Type: | gene_model |
| Chromosome: | Gm08 |
| Start: | 3878216 |
| stop: | 3879150 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Gene model name correspondences to Glyma.08g049600 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.08g049600
>Glyma.08g049600.3 sequence-type=CDS polypeptide=Glyma.08g049600.3.p locus=Glyma.08g049600 id=Glyma.08g049600.3.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGGTCTGCATTCCTTCTACCATTTTCTGATTATCCTTGCATTAATCGCATCCTTTTTGTTCATGCTGTCGACTCAAGTTAGTGCAGATTCGGAGATTCGGAGAAAGCTTGGGATCCACCCAAGCCCACCTACTCCACCTTACACCCCCCCAGCACCGAAACCGGGCGGTTTATACTAA
Predicted protein sequences of Glyma.08g049600
>Glyma.08g049600.3.p sequence-type=predicted peptide transcript=Glyma.08g049600.3 locus=Glyma.08g049600 id=Glyma.08g049600.3.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MGLHSFYHFLIILALIASFLFMLSTQVSADSEIRRKLGIHPSPPTPPYTPPAPKPGGLY*