SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.08g043400

Feature Type:gene_model
Chromosome:Gm08
Start:3420318
stop:3422330
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.08g043400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24830.1AT arginosuccinate synthase family JGI N/AIEA
GO:0000050GO-bp urea cycle EnsemblGenomesN/AIEA
GO:0000053GO-bp argininosuccinate metabolic process EnsemblGenomesN/AIEA
GO:0006526GO-bp arginine biosynthetic process EnsemblGenomesN/AIEA
GO:0006526GO-bp arginine biosynthetic process JGI N/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0004055GO-mf argininosuccinate synthase activity EnsemblGenomesN/AIEA
GO:0004055GO-mf argininosuccinate synthase activity JGI N/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
PTHR11587Panther ARGININOSUCCINATE SYNTHASE JGI N/AIEA
PF00764PFAM Arginosuccinate synthase JGI N/AIEA
ARGSYN-PWYSoyCyc9 L-arginine biosynthesis I (via L-ornithine) Plant Metabolic Network ISS
ARGSYNBSUB-PWYSoyCyc9 L-arginine biosynthesis II (acetyl cycle) Plant Metabolic Network ISS
PWY-4983SoyCyc9 nitric oxide biosynthesis II (mammals) Plant Metabolic Network ISS
PWY-4984SoyCyc9 urea cycle Plant Metabolic Network ISS
GN7V-42230SoyCyc9-rxn argininosuccinate synthase Plant Metabolic Network ISS

Expression Patterns of Glyma.08g043400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.08g043400 not represented in the dataset
Glyma.08g043400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.08g043400
ParalogEvidenceComments
Glyma.05g236000 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.08g043400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma08g04815 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.08g043400
>Glyma.08g043400.1 sequence-type=CDS polypeptide=Glyma.08g043400.1.p locus=Glyma.08g043400 ID=Glyma.08g043400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTTGATGCTGCCGAAGAAGTTGGAGCTGATGCTGTCTCCCATGGGTGTACAGGGAAAGGAAATGATCAGGTTCGATTTGAACTTACTTTCTTTGCTCTGAACCCCAAGCTAAATGTTGTGGCTCCATGGAGGGAGTGGGATATTACAGGTAGAGAACTTGCTATCGAGTATGCTAAAAAGCATAATATATCCGTTCCTGTGACAAAGAAATCCATATATAGCAGGGATAGGAATCTTTGGCACCTAAGCCATGAGAGTGATATTTTGGAAGACCCAGCTAATGAGCCTAAAAAGGACATGTACATGATGCCTGTAGATCCTGAGGATGCTCCTGATCAAGCAGAATATGTGGAAATTGAGATAGAGTGGGGCCTTCCTGTTTCAGTCAATGGGAAGAGGCTTTGGCCAGCATATTTACTTACTGAGCTCAATGAGATTGGTGGAAGGCATGGAATTGGCCGGATCGACATGGTTGAGAATCGGCTTGTGGGTATGAAGAGCCGTGGAGTTTATGATACTCCAGGTGGAACCATCCTGTTTGCTGCAGCACGCGAGCTGGAGTTTTTGACACTTGATCGAGAAACAATACAAGTCAAAGATTCATTAGCCCTTAAATATGCAGAGTTAGTATATGCTGGCAGATGGTTTGATCCGCTTCGGGAGTCCATGGATGCCTTAATGCAGAAGATCACAGAGACAACAACAGGTTCGGTGACTTTGAAATTGTACTAA
Predicted protein sequences of Glyma.08g043400
>Glyma.08g043400.1.p sequence-type=predicted peptide transcript=Glyma.08g043400.1 locus=Glyma.08g043400 ID=Glyma.08g043400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVDAAEEVGADAVSHGCTGKGNDQVRFELTFFALNPKLNVVAPWREWDITGRELAIEYAKKHNISVPVTKKSIYSRDRNLWHLSHESDILEDPANEPKKDMYMMPVDPEDAPDQAEYVEIEIEWGLPVSVNGKRLWPAYLLTELNEIGGRHGIGRIDMVENRLVGMKSRGVYDTPGGTILFAAARELEFLTLDRETIQVKDSLALKYAELVYAGRWFDPLRESMDALMQKITETTTGSVTLKLY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo