|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G26300.1 | AT | cytochrome P450, family 71, subfamily B, polypeptide 34 | JGI | N/A | IEA |
GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
GO:0005506 | GO-mf | iron ion binding | EnsemblGenomes | N/A | IEA |
GO:0016705 | GO-mf | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | EnsemblGenomes | N/A | IEA |
GO:0020037 | GO-mf | heme binding | EnsemblGenomes | N/A | IEA |
PWY-6540 | SoyCyc9 | costunolide biosynthesis | Plant Metabolic Network | ISS | |
GN7V-67036 | SoyCyc9-rxn | costunolide synthase | Plant Metabolic Network | ISS |
Glyma.08g040600 not represented in the dataset |
Glyma.08g040600 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma08g04521 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.08g040600.1 sequence-type=CDS polypeptide=Glyma.08g040600.1.p locus=Glyma.08g040600 ID=Glyma.08g040600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAAAAAGCATGCTTTTCTTCCAGTTCGGGAATTTATTAGCCAAAATGAAATAATAGAGAGAACTTTTTGGACTAATCACAATAATAATTTTATTGAATCATATAAAGTACTTAATTATAAGACAAACTCAATCTCATTTACAGACATAACAAACTCTCCTGGTGCTGATGAAGACTCGTGGTTAACAGAAGCAGAATCATACGATCCTTCAAGCTTCATAATATTGGTATTCTCCGCCATCTTCCTGCGTCCAAAACAGAGCAAAGATGGCCCGCCAGGCCCACCGGGCTTCCCGGTGATCGGAAACCTGCAAGCCTTGGCCCAGCAATACGGTCCCGTCATGTCCCTCCGCCTCGGACAGGTCCCACACGGGTAG
>Glyma.08g040600.1.p sequence-type=predicted peptide transcript=Glyma.08g040600.1 locus=Glyma.08g040600 ID=Glyma.08g040600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MKKHAFLPVREFISQNEIIERTFWTNHNNNFIESYKVLNYKTNSISFTDITNSPGADEDSWLTEAESYDPSSFIILVFSAIFLRPKQSKDGPPGPPGFPVIGNLQALAQQYGPVMSLRLGQVPHG*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||