Report for Sequence Feature Glyma.08g026000
| Feature Type: | gene_model |
| Chromosome: | Gm08 |
| Start: | 2053505 |
| stop: | 2054386 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.08g026000
Gene model name correspondences to Glyma.08g026000 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma08g02970 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.08g026000
>Glyma.08g026000.2 sequence-type=CDS polypeptide=Glyma.08g026000.2.p locus=Glyma.08g026000 id=Glyma.08g026000.2.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGAGAACAACGACAGCATCATATCGCGGGAGAAGATCGACCAGGCAGCGGTGTGGCTCGGCTCCGCCGTCTCTTCCGCTTTCTTTTCCTCATTGGAACGCTTTTCCTGCGTCAACGTCGCCACCTCTGACCCCGACAACGACGATGACGACGACGATTATTACTCCACCACCACCGCCACTCCCACCTCCGCATCCACCACCACCACCACCGCCCTCGCCACCACTCCTCCCTCCGTTCAGGTCAACGGGGAAAAAACAAACGACGACGTCTCCAACCTCCCCGTTTGA
Predicted protein sequences of Glyma.08g026000
>Glyma.08g026000.2.p sequence-type=predicted peptide transcript=Glyma.08g026000.2 locus=Glyma.08g026000 id=Glyma.08g026000.2.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MENNDSIISREKIDQAAVWLGSAVSSAFFSSLERFSCVNVATSDPDNDDDDDDYYSTTTATPTSASTTTTTALATTPPSVQVNGEKTNDDVSNLPV*