Glyma.08g009700

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.08g009700

Feature Type:	gene_model
Chromosome:	Gm08
Start:	753940
stop:	756150
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.08g009700

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13180.1	AT	NAC domain containing protein 83	JGI	N/A	IEA
GO:0006351	GO-bp	transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0006355	GO-bp	regulation of transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0006355	GO-bp	regulation of transcription, DNA-templated	JGI	N/A	IEA
GO:0005634	GO-cc	nucleus	EnsemblGenomes	N/A	IEA
GO:0003677	GO-mf	DNA binding	EnsemblGenomes	N/A	IEA
GO:0003677	GO-mf	DNA binding	JGI	N/A	IEA
PF02365	PFAM	No apical meristem (NAM) protein	JGI	N/A	IEA

Proteins Associated with Glyma.08g009700

Locus	Gene Symbol	Protein Name
	NAC054	NAC Transcription Factor gene 54

Expression Patterns of Glyma.08g009700

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.08g009700

Paralog	Evidence	Comments
Glyma.05g202300	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.08g009700 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma08g01280	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.08g009700

Limit To All Plant Sequences

>Glyma.08g009700.1 sequence-type=CDS polypeptide=Glyma.08g009700.1.p locus=Glyma.08g009700 ID=Glyma.08g009700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAAAAGCTGAATTTTGTTAAAAATGGAGTGAGCAAATTGCCTCCTGGTTTTCGTTTTCAGCCAACAGATGAAGAGCTTGTTTTTCAATACTTGAAATGTAAGGTCTTCTCCTACCCCTTGCCTGCTTCTATCATTCCCGAGATCAATGTCTGCAAGTATGATCCTTGGGATTTGCCAGGGAATTGTGATCTACAAGAGAGGCACTTTTTCAGCCCGAAGGAAGCAAAATATCGAAATGGTAATCGCATGAACCGAACAACAAAGTGTGGCTATTGGAAGGCAACAGGATCAGACAAAAGAATATCATCTTCAACGTGTAACAATGGTATTGTTGGGGTACGAAAAACATTGATATTTTATGAAGGCAAATCACCAAAAGGCTCCAGAACTCACTGGGTCTTGCACGAATATCGTCTCGTCAGTGTAGAAACTGGTGCTGCCAACTCATCCCATAATAACTATGTGAACGAGATAGGAGATTGGGTTCTGTGTCGCTTATCGATGAAGAAAAGAAGTCTAGAAAGTGATGGCAGCGCCACTCATCAGAAGCATAGGCAAAATAATACAGTTCAAACTAGTCGTCCAAGATTAATGTTTGATTTTATGATGGTAGGGAAGACCAATTCTTCTACATCCTCATCATGTTCAAGTTCCAGTAACATCATGGAGGTTTCTTCAAATGCATCGGACCATGAAGAAACAAGTGGCTATGCCCATTTTTAG

Predicted protein sequences of Glyma.08g009700

Limit To All Plant Sequences

>Glyma.08g009700.1.p sequence-type=predicted peptide transcript=Glyma.08g009700.1 locus=Glyma.08g009700 ID=Glyma.08g009700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEKLNFVKNGVSKLPPGFRFQPTDEELVFQYLKCKVFSYPLPASIIPEINVCKYDPWDLPGNCDLQERHFFSPKEAKYRNGNRMNRTTKCGYWKATGSDKRISSSTCNNGIVGVRKTLIFYEGKSPKGSRTHWVLHEYRLVSVETGAANSSHNNYVNEIGDWVLCRLSMKKRSLESDGSATHQKHRQNNTVQTSRPRLMFDFMMVGKTNSSTSSSCSSSSNIMEVSSNASDHEETSGYAHF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain