|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G53460.1 | AT | NADH-dependent glutamate synthase 1 | JGI | N/A | IEA |
| GLUGLNSYN-PWY | SoyCyc9 | L-glutamate biosynthesis IV | Plant Metabolic Network | ISS | |
| PWY-3282 | SoyCyc9 | superpathway of ammonia assimilation (plants) | Plant Metabolic Network | ISS | |
| PWY-6963 | SoyCyc9 | ammonia assimilation cycle I | Plant Metabolic Network | ISS | |
| GN7V-65341 | SoyCyc9-rxn | glutamate synthase (NADH) | Plant Metabolic Network | ISS |
|
Glyma.08G269200 not represented in the dataset |
Glyma.08G269200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g269200 | Wm82.a4.v1 | ISS | As supplied by JGI |
>Glyma.08g269200.1 sequence-type=CDS polypeptide=Glyma.08g269200.1.p locus=Glyma.08g269200 ID=Glyma.08g269200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGATATCCCTCTTTTTTATTCACATAGGTGCTTGCGGTTGCGGCTGTGAAGCCAACACTGGAGATGGAGCAGGGATCATGGTGGCTCTACCTCACCAGTTTTACGAGTGGCCGTCAGATTTGGAGGATGTCTATCCAAGATGGACTGCAAACTCTCACTACACCTTGGTACCAATTCTGGAGGGACAACAACTTGATGACTCAAGATGA
>Glyma.08g269200.1.p sequence-type=predicted peptide transcript=Glyma.08g269200.1 locus=Glyma.08g269200 ID=Glyma.08g269200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MISLFFIHIGACGCGCEANTGDGAGIMVALPHQFYEWPSDLEDVYPRWTANSHYTLVPILEGQQLDDSR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||