|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G51650.1 | AT | ATP synthase epsilon chain, mitochondrial | JGI | N/A | IEA |
| GO:0015986 | GO-bp | ATP synthesis coupled proton transport | EnsemblGenomes | N/A | IEA |
| GO:0015986 | GO-bp | ATP synthesis coupled proton transport | JGI | N/A | IEA |
| GO:0099132 | GO-bp | ATP hydrolysis coupled cation transmembrane transport | EnsemblGenomes | N/A | IEA |
| GO:0000275 | GO-cc | mitochondrial proton-transporting ATP synthase complex, catalytic core F(1) | EnsemblGenomes | N/A | IEA |
| GO:0000275 | GO-cc | mitochondrial proton-transporting ATP synthase complex, catalytic core F(1) | JGI | N/A | IEA |
| GO:0046933 | GO-mf | proton-transporting ATP synthase activity, rotational mechanism | EnsemblGenomes | N/A | IEA |
| GO:0046933 | GO-mf | proton-transporting ATP synthase activity, rotational mechanism | JGI | N/A | IEA |
| GO:0046961 | GO-mf | proton-transporting ATPase activity, rotational mechanism | JGI | N/A | IEA |
| KOG3495 | KOG | Mitochondrial F1F0-ATP synthase, subunit epsilon/ATP15 | JGI | N/A | IEA |
| PTHR12448 | Panther | ATP SYNTHASE EPSILON CHAIN, MITOCHONDRIAL | JGI | N/A | IEA |
| PF04627 | PFAM | Mitochondrial ATP synthase epsilon chain | JGI | N/A | IEA |
| PWY-7219 | SoyCyc9 | adenosine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7229 | SoyCyc9 | superpathway of adenosine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-841 | SoyCyc9 | superpathway of purine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS |
|
Glyma.08G222900 not represented in the dataset |
Glyma.08G222900 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.07g003700 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.08g222900 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma08g23830 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.08g222900.1 sequence-type=CDS polypeptide=Glyma.08g222900.1.p locus=Glyma.08g222900 ID=Glyma.08g222900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCGTCGAGCGGAGCGGTGCCGTTTTGGAGGGCAGCGGGGATGACATACATCACATACTCAAACATATGCGCGAATCTGGTCAGGAATTGCCTCAAGGAACCCTACAAGGCTGAAGCCATCTCTCGTGAGAAGGTCCATTTTGCTCTCTCCAAATGGGTCGACGCCAAGCCTGAAAAACCTAACACCCCAGAGCAGTGA
>Glyma.08g222900.1.p sequence-type=predicted peptide transcript=Glyma.08g222900.1 locus=Glyma.08g222900 ID=Glyma.08g222900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MASSGAVPFWRAAGMTYITYSNICANLVRNCLKEPYKAEAISREKVHFALSKWVDAKPEKPNTPEQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||