SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.08G146800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.08G146800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.08G146800

Feature Type:gene_model
Chromosome:Gm08
Start:11173407
stop:11176423
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09920.1AT RNA polymerase II, Rpb4, core protein JGI N/AIEA
GO:0000288GO-bp nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay EnsemblGenomesN/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006351GO-bp transcription, DNA-templated JGI N/AIEA
GO:0006352GO-bp DNA-templated transcription, initiation EnsemblGenomesN/AIEA
GO:0006367GO-bp transcription initiation from RNA polymerase II promoter EnsemblGenomesN/AIEA
GO:0031990GO-bp mRNA export from nucleus in response to heat stress EnsemblGenomesN/AIEA
GO:0034402GO-bp recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex EnsemblGenomesN/AIEA
GO:0044237GO-bp cellular metabolic process EnsemblGenomesN/AIEA
GO:0045948GO-bp positive regulation of translational initiation EnsemblGenomesN/AIEA
GO:0000932GO-cc P-body EnsemblGenomesN/AIEA
GO:0005665GO-cc DNA-directed RNA polymerase II, core complex EnsemblGenomesN/AIEA
GO:0030880GO-cc RNA polymerase complex EnsemblGenomesN/AIEA
GO:0055029GO-cc nuclear DNA-directed RNA polymerase complex EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0003697GO-mf single-stranded DNA binding EnsemblGenomesN/AIEA
GO:0003727GO-mf single-stranded RNA binding EnsemblGenomesN/AIEA
GO:0003824GO-mf catalytic activity EnsemblGenomesN/AIEA
GO:0003899GO-mf DNA-directed 5'-3' RNA polymerase activity EnsemblGenomesN/AIEA
GO:0003899GO-mf DNA-directed RNA polymerase activity JGI N/AIEA
GO:0031369GO-mf translation initiation factor binding EnsemblGenomesN/AIEA
KOG2351 KOG RNA polymerase II, fourth largest subunit JGI N/AIEA
PTHR21297Panther DNA-DIRECTED RNA POLYMERASE II JGI N/AIEA
PF03874PFAM RNA polymerase Rpb4 JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.08G146800 not represented in the dataset

Glyma.08G146800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.05g189100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g146800 Wm82.a4.v1ISS As supplied by JGI
Glyma08g15515 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.08g146800.1 sequence-type=CDS polypeptide=Glyma.08g146800.1.p locus=Glyma.08g146800 ID=Glyma.08g146800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTACGTGGAAAAGGAAGAAAACGCCGCAGAGCTCAAAATTGGAGACGAGTTTTTGAAGGCAAAGTGCTTAATGAACTGTGAAGTTGCATTGATTCCTGAGCACAAGGTATTTGAAAAGTCACAGCAGTATGTAAAGCGTTTCAGCCGCTATAAAAATCCCGATGCTGTTAGAGACAAAATTCTCGCAAGATATCAATTGGCTGAGTTTGAGTTGTGTGTCCTTGGCAACCTTTGCCTAGAAACTGTGGAGGAAGCTATTGCTATGGTTCCATCTATCGAGTCAAGAGGACGGGCTCAAGATGATGAAGCAATCGAGAAAATGTTAAATGACTTGTCTTTGATTAAGAAATTTGAATAA

>Glyma.08g146800.1.p sequence-type=predicted peptide transcript=Glyma.08g146800.1 locus=Glyma.08g146800 ID=Glyma.08g146800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MYVEKEENAAELKIGDEFLKAKCLMNCEVALIPEHKVFEKSQQYVKRFSRYKNPDAVRDKILARYQLAEFELCVLGNLCLETVEEAIAMVPSIESRGRAQDDEAIEKMLNDLSLIKKFE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo