|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G18360.2 | AT | Aldolase-type TIM barrel family protein | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0003824 | GO-mf | catalytic activity | EnsemblGenomes | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | JGI | N/A | IEA |
| PF01070 | PFAM | FMN-dependent dehydrogenase | JGI | N/A | IEA |
| GN7V-65796 | SoyCyc9-rxn | (S)-2-hydroxy-acid oxidase | Plant Metabolic Network | ISS |
|
Glyma.08G097200 not represented in the dataset |
Glyma.08G097200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
>Glyma.08g097200.1 sequence-type=CDS polypeptide=Glyma.08g097200.1.p locus=Glyma.08g097200 ID=Glyma.08g097200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGATTGCTCCAACAGCCAAGCAAAAGATGGCTCACCCTGAAGGAGAATTAGATACTGCTAGAGCAGCATCAGCAGCTGGCACAATCATGGTTTAA
>Glyma.08g097200.1.p sequence-type=predicted peptide transcript=Glyma.08g097200.1 locus=Glyma.08g097200 ID=Glyma.08g097200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MIAPTAKQKMAHPEGELDTARAASAAGTIMV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||