SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.08G013800

Feature Type:gene_model
Chromosome:Gm08
Start:1074679
stop:1077283
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.08G013800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11600.1AT glutathione peroxidase 6 JGI N/AIEA
GO:0006979GO-bp response to oxidative stress EnsemblGenomesN/AIEA
GO:0006979GO-bp response to oxidative stress JGI N/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0098869GO-bp cellular oxidant detoxification EnsemblGenomesN/AIEA
GO:0004601GO-mf peroxidase activity EnsemblGenomesN/AIEA
GO:0004602GO-mf glutathione peroxidase activity EnsemblGenomesN/AIEA
GO:0004602GO-mf glutathione peroxidase activity JGI N/AIEA
GO:0016209GO-mf antioxidant activity JGI N/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity JGI N/AIEA
KOG1651 KOG Glutathione peroxidase JGI N/AIEA
PTHR11592Panther GLUTATHIONE PEROXIDASE JGI N/AIEA
PF00255PFAM Glutathione peroxidase JGI N/AIEA
PWY-4081SoyCyc9 glutathione-peroxide redox reactions Plant Metabolic Network ISS
GN7V-45234SoyCyc9-rxn phospholipid-hydroperoxide glutathione peroxidase Plant Metabolic Network ISS

Proteins Associated with Glyma.08G013800
LocusGene SymbolProtein Name
GPX Glutathione Peroxidase

Expression Patterns of Glyma.08G013800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.08G013800
ParalogEvidenceComments
Glyma.05g207100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.08G013800 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.08g013800 Wm82.a4.v1ISS As supplied by JGI
Glyma08g01700 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.08G013800
>Glyma.08g013800.1 sequence-type=CDS polypeptide=Glyma.08g013800.1.p locus=Glyma.08g013800 ID=Glyma.08g013800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCTCTCTATTTCAGCCACTCGTATATTCTTCCTCCGCTCAACAACTATAAGATTATCTTCTTCTTCTTCTTCTCTTCAATTCTTCTCCAATCCCAACCGCACCCTCTTCCGTCCCTTTCTTCACACTTCCTTCAAACCACTTCCTTCGTCTTTCTCTTTCCGAACAGATCACACTATGGCCACCTCAAACGCCAAATCAGTCCATGATTTCACCGTTAAAGATGCCAAGGGAAATGATATTAACCTTGGTGACTACAAAGGAAAGGTCCTTATCATTGTCAATGTTGCCTCACAATGTGGCTTGACTAATTCAAATTACACTGAGCTCAGTCAGTTGTATGAGAAATACAAACAGAAAGGTCTGGAAATTCTGGCGTTCCCATGCAATCAGTTTGGGGCACAGGAGCCTGGATCTAATGAACAGATACAAGAGTTTGTTTGTACTCGCTTCAAGGCTGAGTTTCCCGTTTTTGACAAGGTTGATGTGAATGGTGACAAGGCTGCTCCACTGTACAAATATCTAAAATCAAGCAAAGGTGGACTCCTTGGGGATGGCATCAAATGGAACTTCGCCAAGTTCCTTGTTGATAAAGAGGGGAATGTTGTTGATCGCTATGCACCCACAACTTCTCCTCTGAGCATTGAGAAGGACTTGCTGAAGTTGTTGGATGCATGA
Predicted protein sequences of Glyma.08G013800
>Glyma.08g013800.1.p sequence-type=predicted peptide transcript=Glyma.08g013800.1 locus=Glyma.08g013800 ID=Glyma.08g013800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLSISATRIFFLRSTTIRLSSSSSSLQFFSNPNRTLFRPFLHTSFKPLPSSFSFRTDHTMATSNAKSVHDFTVKDAKGNDINLGDYKGKVLIIVNVASQCGLTNSNYTELSQLYEKYKQKGLEILAFPCNQFGAQEPGSNEQIQEFVCTRFKAEFPVFDKVDVNGDKAAPLYKYLKSSKGGLLGDGIKWNFAKFLVDKEGNVVDRYAPTTSPLSIEKDLLKLLDA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo