SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.07g262900

Feature Type:gene_model
Chromosome:Gm07
Start:43733936
stop:43734310
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.07g262900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11925.1AT Stigma-specific Stig1 family protein JGI N/AIEA
PF04885PFAM Stigma-specific protein, Stig1 JGI N/AIEA

Expression Patterns of Glyma.07g262900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.07g262900
ParalogEvidenceComments
Glyma.17g011100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.07g262900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma07g39280 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.07g262900
>Glyma.07g262900.1 sequence-type=CDS polypeptide=Glyma.07g262900.1.p locus=Glyma.07g262900 ID=Glyma.07g262900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAGACCCTCTTCCTTCTAGCCATGCTAATGGCTTTGGCTGTTTTTGTGTCAGCAATATCTCCCGGAAGTGAAAAACCAAAAGGGAAAATTAATCGATTTCTTTCTGACAGGGTGGTGCTGACATGTGAAAAATACCCTGAGGTATGCCTCATTAAAGGAAGCGCAGGATCTGATTGCTGCAAGAACAAATGTGTCAACCTTTCCACAGATGTCTCCAATTGTGGGAAATGTGGAAAGAAATGTAGCTATGGTAAGATATGTTGCGAAGGTAAGTGCGTGAATCCTCGGACTAACGAGAAGCATTGTGGGAAATGTGACAACAAGTGCAACTCTGAGAGTTCATGTATCTATGGAATGTGTAGCTACGCGTAG
Predicted protein sequences of Glyma.07g262900
>Glyma.07g262900.1.p sequence-type=predicted peptide transcript=Glyma.07g262900.1 locus=Glyma.07g262900 ID=Glyma.07g262900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKTLFLLAMLMALAVFVSAISPGSEKPKGKINRFLSDRVVLTCEKYPEVCLIKGSAGSDCCKNKCVNLSTDVSNCGKCGKKCSYGKICCEGKCVNPRTNEKHCGKCDNKCNSESSCIYGMCSYA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo