|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G27700.1 | AT | Ribosomal protein S21e | JGI | N/A | IEA |
| GO:0000447 | GO-bp | endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) | EnsemblGenomes | N/A | IEA |
| GO:0000461 | GO-bp | endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) | EnsemblGenomes | N/A | IEA |
| GO:0006412 | GO-bp | translation | EnsemblGenomes | N/A | IEA |
| GO:0006412 | GO-bp | translation | JGI | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | JGI | N/A | IEA |
| GO:0005840 | GO-cc | ribosome | EnsemblGenomes | N/A | IEA |
| GO:0005840 | GO-cc | ribosome | JGI | N/A | IEA |
| GO:0022627 | GO-cc | cytosolic small ribosomal subunit | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | JGI | N/A | IEA |
| KOG3486 | KOG | 40S ribosomal protein S21 | JGI | N/A | IEA |
| PTHR10442 | Panther | 40S RIBOSOMAL PROTEIN S21 | JGI | N/A | IEA |
| PF01249 | PFAM | Ribosomal protein S21e | JGI | N/A | IEA |
|
Glyma.07g247600 not represented in the dataset |
Glyma.07g247600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma07g37700 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.07g247600.1 sequence-type=CDS polypeptide=Glyma.07g247600.1.p locus=Glyma.07g247600 ID=Glyma.07g247600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTACTACGTTGTCACGTTTTTTCGAATTGTGGTTCTTTTGTGGAATTTGAACTGATGTTATTGTTAAAGCACGTACGTTGCAACTCTGCCACTAACAGACTCATAACTGCAAAGGACCATGCCTCGGTTCAGATAAACATTGGCCATTTGGATGAGAATGGTATCTATAATGGTCATTTTTCCACTTCTGCTCTCTCTGGCTTCGTTCGAGCACAGGGTGATGCTAACAGTGCATTAGATAGGTTGTGGCAGAAGAAGAAAGCAGAAGTTAAGCAACACTAG
>Glyma.07g247600.1.p sequence-type=predicted peptide transcript=Glyma.07g247600.1 locus=Glyma.07g247600 ID=Glyma.07g247600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVLRCHVFSNCGSFVEFELMLLLKHVRCNSATNRLITAKDHASVQINIGHLDENGIYNGHFSTSALSGFVRAQGDANSALDRLWQKKKAEVKQH*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||