|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G17420.1 | AT | lipoxygenase 3 | JGI | N/A | IEA |
GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
GO:0016702 | GO-mf | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | EnsemblGenomes | N/A | IEA |
GO:0016702 | GO-mf | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | JGI | N/A | IEA |
GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
GO:0046872 | GO-mf | metal ion binding | JGI | N/A | IEA |
PF00305 | PFAM | Lipoxygenase | JGI | N/A | IEA |
PWY-5406 | SoyCyc9 | divinyl ether biosynthesis I | Plant Metabolic Network | ISS | |
PWY-5407 | SoyCyc9 | 9-lipoxygenase and 9-allene oxide synthase pathway | Plant Metabolic Network | ISS | |
GN7V-65433 | SoyCyc9-rxn | linoleate 9S-lipoxygenase | Plant Metabolic Network | ISS |
Glyma.07g177800 not represented in the dataset |
Glyma.07g177800 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma07g29196 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.07g177800.1 sequence-type=CDS polypeptide=Glyma.07g177800.1.p locus=Glyma.07g177800 ID=Glyma.07g177800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGGCCAGGCTCTGAAGCTAGCAATGTTGTTTTTGAGTACAAATGGCAGCCTAGTGGAAAGACTAGTCGATCTTCATGAAGCAAGAGGAGTTGCTGTTAAGGATCCATCTGCTCCCCATGGAGTTCGACTTTTGATCGAGGACTATCCTTATGCTTCTGATGGGCTAGAGATATGGGATGCTATCAAGTCTAAAGGATATTGA
>Glyma.07g177800.1.p sequence-type=predicted peptide transcript=Glyma.07g177800.1 locus=Glyma.07g177800 ID=Glyma.07g177800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MGQALKLAMLFLSTNGSLVERLVDLHEARGVAVKDPSAPHGVRLLIEDYPYASDGLEIWDAIKSKGY*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||