SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.07g144400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.07g144400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.07g144400

Feature Type:gene_model
Chromosome:Gm07
Start:17209390
stop:17210181
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G38050.1AT 3-oxo-5-alpha-steroid 4-dehydrogenase family protein JGI N/AIEA
GO:0006629GO-bp lipid metabolic process EnsemblGenomesN/AIEA
GO:0006629GO-bp lipid metabolic process JGI N/AIEA
GO:0008202GO-bp steroid metabolic process EnsemblGenomesN/AIEA
GO:0016132GO-bp brassinosteroid biosynthetic process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm JGI N/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane JGI N/AIEA
GO:0003865GO-mf 3-oxo-5-alpha-steroid 4-dehydrogenase activity EnsemblGenomesN/AIEA
GO:0016627GO-mf oxidoreductase activity, acting on the CH-CH group of donors EnsemblGenomesN/AIEA
GO:0016627GO-mf oxidoreductase activity, acting on the CH-CH group of donors JGI N/AIEA
KOG1638 KOG Steroid reductase JGI N/AIEA
PTHR10556Panther 3-OXO-5-ALPHA-STEROID 4-DEHYDROGENASE JGI N/AIEA
PTHR10556:SF2Panther STEROID 5-ALPHA-REDUCTASE DET2 JGI N/AIEA
PF02544PFAM 3-oxo-5-alpha-steroid 4-dehydrogenase JGI N/AIEA
PWY-2582SoyCyc9 brassinosteroid biosynthesis II Plant Metabolic Network ISS
PWY-6544SoyCyc9 superpathway of C28 brassinosteroid biosynthesis Plant Metabolic Network ISS
PWY-699SoyCyc9 brassinosteroid biosynthesis I Plant Metabolic Network ISS
GN7V-44730SoyCyc9-rxn campest-4-en-3-one,NADPH:steroid 5α-reductase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.07g144400 not represented in the dataset

Glyma.07g144400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma07g17410 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.07g144400.1 sequence-type=CDS polypeptide=Glyma.07g144400.1.p locus=Glyma.07g144400 ID=Glyma.07g144400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATCCCAGAACACTACTCCGACTCATCTCTCTTCCACAGCTCCCTCCTTACCCTCTTCCTAATCGCACCCCCCACCTTCCTCTCCCTCACCTTCCTCCAGGCCCCCTACGGCAAGCACCACAGGCCCGGCTGGGGGCCCAACCTCCCTCCCCCCTTAGCCTGGCTCCTCATGGAAAGCCCAACCCTCTGGCTCACCCTCCTGCTCTTCCCACTGGGCCTCCACTCCCACAACCCCAAAGCCCAGGCCCTCATCACCCCCTTCCTAATCCACTACTTCAACCGCACCATCCTCTACCCTCTCCACCTCCTCCTCACTCCTTCAAAGAAAACCACACCGGGCTTCCCCCTCAGCGTAGCCCTAATGGCATTCGCCTTCAACGTTCTCAATTCCTACCTCCAGGCCCGAACGGTCTCTCACTACAACAATCACTATGATGACTCGGGCTTTTTCTGGTTCCGGTTTTTGTGTGGGCTTTTGGTGTTTTTATTGGGGATGGGGATTAATGTATGGGCTGATAGGGTTTTGTTGCGGCTCAAGAGCGAGGGAAAGGGCTACGTGGTGCCGCGCGGTGGGTTGTTCGAGCTCGTGGCGTGTCCGAATTACTTTGGGGAGATTGTCGAGTGGCTCGGCTGGGCCGTGATGACTTGGTCATGGGCCGGGCTGGGCTTTTTTGTTTACACTTTTGCGAATTTGGGTCCAAGGGCCCGGGCCAACCGTAGGTGGTATTTGGAGAAGTTTGGGGAGGATTATCCAAAGGAGAGAAAGGCTGTTATTCCTTACTTGTATTGA

>Glyma.07g144400.1.p sequence-type=predicted peptide transcript=Glyma.07g144400.1 locus=Glyma.07g144400 ID=Glyma.07g144400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MIPEHYSDSSLFHSSLLTLFLIAPPTFLSLTFLQAPYGKHHRPGWGPNLPPPLAWLLMESPTLWLTLLLFPLGLHSHNPKAQALITPFLIHYFNRTILYPLHLLLTPSKKTTPGFPLSVALMAFAFNVLNSYLQARTVSHYNNHYDDSGFFWFRFLCGLLVFLLGMGINVWADRVLLRLKSEGKGYVVPRGGLFELVACPNYFGEIVEWLGWAVMTWSWAGLGFFVYTFANLGPRARANRRWYLEKFGEDYPKERKAVIPYLY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo