Glyma.07g116400

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.07g116400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.07g116400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.07g116400

Feature Type:	gene_model
Chromosome:	Gm07
Start:	12791212
stop:	12792092
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.07g116400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G14710.1	AT	RmlC-like cupins superfamily protein	JGI	N/A	IEA
GO:0006555	GO-bp	methionine metabolic process	EnsemblGenomes	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	EnsemblGenomes	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	JGI	N/A	IEA
GO:0010309	GO-mf	acireductone dioxygenase [iron(II)-requiring] activity	EnsemblGenomes	N/A	IEA
GO:0010309	GO-mf	acireductone dioxygenase [iron(II)-requiring] activity	JGI	N/A	IEA
KOG2107	KOG	Uncharacterized conserved protein, contains double-stranded beta-helix domain	JGI	N/A	IEA
PTHR23418	Panther	ACIREDUCTONE DIOXYGENASE	JGI	N/A	IEA
PF03079	PFAM	ARD/ARD' family	JGI	N/A	IEA
PWY-4361	SoyCyc9	S-methyl-5-thio-α-D-ribose 1-phosphate degradation	Plant Metabolic Network		ISS
PWY-7270	SoyCyc9	L-methionine salvage cycle II (plants)	Plant Metabolic Network		ISS
PWY-7528	SoyCyc9	L-methionine salvage cycle I (bacteria and plants)	Plant Metabolic Network		ISS
GN7V-62057	SoyCyc9-rxn	acireductone dioxygenase [iron(II)-requiring]	Plant Metabolic Network		ISS

Expression Patterns of Glyma.07g116400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.07g116400 not represented in the dataset	Glyma.07g116400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.07g116400 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma07g13585	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.07g116400

Limit To All Plant Sequences

>Glyma.07g116400.1 sequence-type=CDS polypeptide=Glyma.07g116400.1.p locus=Glyma.07g116400 ID=Glyma.07g116400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAATCGACATCTGCCATTAATAACATTGGATGATAGTGATGAAGATCAAACACTCCCCCACCACAAAGCACCTAAGGAGTTTGTCTCGTTGGACCAACTTGTTGAACTTGGAGTCCTTAGTTGGAAACTAGATGCTGATAACCATGGAAATGATCCAGAGCTGAAGAAGATTCATGAAGAGCATGGTTACACCTACATGCATTTTCACACTGATGAGGAGATCCTCTTTTGTGCTGCTGGAAGCCGCTATTGTGATGTTAAGGATCACAATGATGCTTGGATTCGTGAGTGGGTCAAGAAAGGAGGAATGATCATCTTACCTGTCAGAATTTATCATCACTTTACGCTAGATGAGAGCAACTACATTAAGGTATTGATTGCATATTTACAAGTATTTTATGGCGAAACTGCTACTTTTTTCTGGTTCTAA

Predicted protein sequences of Glyma.07g116400

Limit To All Plant Sequences

>Glyma.07g116400.1.p sequence-type=predicted peptide transcript=Glyma.07g116400.1 locus=Glyma.07g116400 ID=Glyma.07g116400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MNRHLPLITLDDSDEDQTLPHHKAPKEFVSLDQLVELGVLSWKLDADNHGNDPELKKIHEEHGYTYMHFHTDEEILFCAAGSRYCDVKDHNDAWIREWVKKGGMIILPVRIYHHFTLDESNYIKVLIAYLQVFYGETATFFWF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain