Report for Sequence Feature Glyma.07g098600
| Feature Type: | gene_model |
| Chromosome: | Gm07 |
| Start: | 9155726 |
| stop: | 9156128 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Gene model name correspondences to Glyma.07g098600 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma07g11035 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.07g098600
>Glyma.07g098600.1 sequence-type=CDS polypeptide=Glyma.07g098600.1.p locus=Glyma.07g098600 id=Glyma.07g098600.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGCTCGGACCAGTCTTTCTTCTATATCAATACCTTTTCTTATTCTGCTGATAATAGCCTTTACTTTCTTTGCACAGCTAGCTCCAGTTAGTGCAGATCTGCAAAAGAGAAAATTTGGTCCCATGTCAAGTCCACCTCCTCCACCTAGGCTTTCTCCTGGACCTGGTTCAGGTTGA
Predicted protein sequences of Glyma.07g098600
>Glyma.07g098600.1.p sequence-type=predicted peptide transcript=Glyma.07g098600.1 locus=Glyma.07g098600 id=Glyma.07g098600.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MARTSLSSISIPFLILLIIAFTFFAQLAPVSADLQKRKFGPMSSPPPPPRLSPGPGSG*