SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.07g066100

Feature Type:gene_model
Chromosome:Gm07
Start:5960745
stop:5967003
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.07g066100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01280.2AT Homeodomain-like superfamily protein JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003682GO-mf chromatin binding JGI N/AIEA
KOG0724 KOG Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains JGI N/AIEA
PTHR12802Panther SWI/SNF COMPLEX-RELATED JGI N/AIEA
PTHR12802:SF30Panther JGI N/AIEA
PF00249PFAM Myb-like DNA-binding domain JGI N/AIEA

Proteins Associated with Glyma.07g066100
LocusGene SymbolProtein Name
MYB133 MYB transcription factor MYB133

Expression Patterns of Glyma.07g066100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.07g066100
ParalogEvidenceComments
Glyma.16g032600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.07g066100 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma07g07200 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.07g066100
>Glyma.07g066100.1 sequence-type=CDS polypeptide=Glyma.07g066100.1.p locus=Glyma.07g066100 ID=Glyma.07g066100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGTCGGTGAACCCAAGCCCTGCTCAAGGCTTCTACTTCTTCGATCCCTCCAACATGGCCCTTCCCGGCGTCAACAATCTTCCACCGCCCCCGCTGCCTGCTCCGCCTTCTCACGCCGCCGTGGAGGATCCGAGTAAGAAGATCAGGAAACCCTACACGATTACCAAGTCCAGGGAGAGCTGGACTGAGCAGGAGCACGACAAGTTTCTAGAAGCTCTCCAATTATTTGATCGGGACTGGAAAAAGATTGAAGCATTTGTTGGTTCAAAAACAGTTATCCAGATACGAAGTCATGCACAGAAGTATTTTCTTAAAGTTCAGAAGAAGGGAACAAGTGAACATGTACCTCCTCCCCGGCCAAAGAGAAAAGCTGCTCGCCCATACCCTCAAAAAGCTCCTAAAACTCCTACTGTATCCCAAGTTATGGGCCCATTGCAATCTTCATCTTCTTTCATTGAACCTGCATACATTTATATCCCGGATTCTTCATCTGCGCTTGGAACTCCAGTTACTAACATGCCTTCGTCATCTTGGAACTATAATAATACACCACAACCTGTCAATGTGCCACAAGTGACCAGAGATGACATGGGATTCACTGTAGCTGGACAAACTGCTCCTCTTAATTGTTGCTGCAGCAGTAGTAATGAGAGCAACCCTCCAACTTGGCCAAGTAGCAAAAGGATTAATCAAGGTGACCAGGAGCCAATTAAAGTAATGCCAGATTTTGCACAAGTCTACAGCTTCATCGGCAGTGTATTCGATCCAAATTCAACTAATCACCTACAGAAACTACGACAGATGGATCCATTAAATGTGGAAACGATATTGTTGTTGATGAGAAATCTCTCCATCAATTTAATGAGTCCTGAATTTGAGGATCATAAGAGGATGCTTTCATCATATGACACCGACTCTGACAAGTCGAAGTTGGTTAATATTTGCAGCAAATCCCTCACTAATAAATCTGAGAGTGCTGTTTTGTCTGCTTAG
Predicted protein sequences of Glyma.07g066100
>Glyma.07g066100.1.p sequence-type=predicted peptide transcript=Glyma.07g066100.1 locus=Glyma.07g066100 ID=Glyma.07g066100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVSVNPSPAQGFYFFDPSNMALPGVNNLPPPPLPAPPSHAAVEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFVGSKTVIQIRSHAQKYFLKVQKKGTSEHVPPPRPKRKAARPYPQKAPKTPTVSQVMGPLQSSSSFIEPAYIYIPDSSSALGTPVTNMPSSSWNYNNTPQPVNVPQVTRDDMGFTVAGQTAPLNCCCSSSNESNPPTWPSSKRINQGDQEPIKVMPDFAQVYSFIGSVFDPNSTNHLQKLRQMDPLNVETILLLMRNLSINLMSPEFEDHKRMLSSYDTDSDKSKLVNICSKSLTNKSESAVLSA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo