SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.07g004900

Feature Type:gene_model
Chromosome:Gm07
Start:381507
stop:384695
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.07g004900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16080.1AT Zinc-binding ribosomal protein family protein JGI N/AIEA
GO:0006412GO-bp translation EnsemblGenomesN/AIEA
GO:0006412GO-bp translation JGI N/AIEA
GO:0005622GO-cc intracellular EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular JGI N/AIEA
GO:0005840GO-cc ribosome EnsemblGenomesN/AIEA
GO:0005840GO-cc ribosome JGI N/AIEA
GO:0022625GO-cc cytosolic large ribosomal subunit EnsemblGenomesN/AIEA
GO:0003723GO-mf RNA binding EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome JGI N/AIEA
GO:0019843GO-mf rRNA binding EnsemblGenomesN/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
KOG3475 KOG 60S ribosomal protein L37 JGI N/AIEA
PTHR10768Panther 60S RIBOSOMAL PROTEIN L37 JGI N/AIEA
PF01907PFAM Ribosomal protein L37e JGI N/AIEA

Proteins Associated with Glyma.07g004900
LocusGene SymbolProtein Name
RPL37 ribosomal protein L37

Expression Patterns of Glyma.07g004900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.07g004900
ParalogEvidenceComments
Glyma.08g205500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.07g004900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma07g00700 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.07g004900
>Glyma.07g004900.1 sequence-type=CDS polypeptide=Glyma.07g004900.1.p locus=Glyma.07g004900 ID=Glyma.07g004900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGTAAGGGAACGGGGAGTTTCGGTAAGAGAAGGAACAAGACCCACACCCTCTGTGTGAGGTGTGGCCGCCGCAGTTTCCACCTCCAGAAGAGTCGTTGCGCCGCGTGCGCTTTCCCCGCTGCGCGCACCAGGAAATATAACTGGAGCGTGAAGGCCATTAGGAGAAAGACCACCGGAACTGGAAGGATGAGGTACTTGCGTAACGTGCCCCGTAGATTTAAGAGTGGCTTCAGAGACGGTACCGAAGCTGCACCCAGGAAGAGAGGAGCTGCTGCCTCTACCTAA
Predicted protein sequences of Glyma.07g004900
>Glyma.07g004900.1.p sequence-type=predicted peptide transcript=Glyma.07g004900.1 locus=Glyma.07g004900 ID=Glyma.07g004900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARTRKYNWSVKAIRRKTTGTGRMRYLRNVPRRFKSGFRDGTEAAPRKRGAAAST*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo