|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G06860.1 | AT | multifunctional protein 2 | JGI | N/A | IEA |
| GO:0006631 | GO-bp | fatty acid metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0006631 | GO-bp | fatty acid metabolic process | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
| GO:0003857 | GO-mf | 3-hydroxyacyl-CoA dehydrogenase activity | EnsemblGenomes | N/A | IEA |
| GO:0003857 | GO-mf | 3-hydroxyacyl-CoA dehydrogenase activity | JGI | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | JGI | N/A | IEA |
| PF00725 | PFAM | 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain | JGI | N/A | IEA |
| PWY-5136 | SoyCyc9 | fatty acid β-oxidation II (peroxisome) | Plant Metabolic Network | ISS | |
| PWY-5137 | SoyCyc9 | fatty acid β-oxidation III (unsaturated, odd number) | Plant Metabolic Network | ISS | |
| PWY-5138 | SoyCyc9 | unsaturated, even numbered fatty acid β-oxidation | Plant Metabolic Network | ISS | |
| PWY-561 | SoyCyc9 | superpathway of glyoxylate cycle and fatty acid degradation | Plant Metabolic Network | ISS | |
| PWY-6837 | SoyCyc9 | fatty acid beta-oxidation V (unsaturated, odd number, di-isomerase-dependent) | Plant Metabolic Network | ISS | |
| PWY-7036 | SoyCyc9 | very long chain fatty acid biosynthesis II | Plant Metabolic Network | ISS | |
| GN7V-56647 | SoyCyc9-rxn | enoyl-CoA isomerase | Plant Metabolic Network | ISS |
|
Glyma.07G246400 not represented in the dataset |
Glyma.07G246400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.17g027600 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.07g246400 | Wm82.a4.v1 | ISS | As supplied by JGI |
>Glyma.07g246400.1 sequence-type=CDS polypeptide=Glyma.07g246400.1.p locus=Glyma.07g246400 ID=Glyma.07g246400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTTCTTCCCATATACGCAAGCAGGTCTCTTGCTTGTTGAACATGGTGCAGATGTTTATCAAATTGATAGAGTAATAACCAAATTTAAAATACCCATGGGACCTTTCAGATTGGTGGACCTTGTTGGGTTTGGTGTGGCGATTGCTACTGGCATGCAATTTATTCAGAATTTTCCTGAGCGAACATATAAATCAATGCTTATTCCCCTTCTCCACTAA
>Glyma.07g246400.1.p sequence-type=predicted peptide transcript=Glyma.07g246400.1 locus=Glyma.07g246400 ID=Glyma.07g246400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MFFPYTQAGLLLVEHGADVYQIDRVITKFKIPMGPFRLVDLVGFGVAIATGMQFIQNFPERTYKSMLIPLLH*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||