|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G40870.1 | AT | uridine kinase/uracil phosphoribosyltransferase 1 | JGI | N/A | IEA |
| GO:0008152 | GO-bp | metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0008152 | GO-bp | metabolic process | JGI | N/A | IEA |
| GO:0016310 | GO-bp | phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0044206 | GO-bp | UMP salvage | EnsemblGenomes | N/A | IEA |
| GO:0004849 | GO-mf | uridine kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | JGI | N/A | IEA |
| GO:0016301 | GO-mf | kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0016301 | GO-mf | kinase activity | JGI | N/A | IEA |
| PTHR10285 | Panther | URIDINE KINASE | JGI | N/A | IEA |
| PTHR10285:SF6 | Panther | URACIL PHOSPHORIBOSYLTRANSFERASE HOMOLOG | JGI | N/A | IEA |
| PF00485 | PFAM | Phosphoribulokinase / Uridine kinase family | JGI | N/A | IEA |
| PWY-7183 | SoyCyc9 | pyrimidine nucleobases salvage I | Plant Metabolic Network | ISS | |
| PWY-7193 | SoyCyc9 | pyrimidine ribonucleosides salvage I | Plant Metabolic Network | ISS | |
| PWY-7196 | SoyCyc9 | superpathway of pyrimidine ribonucleosides salvage | Plant Metabolic Network | ISS | |
| PWY-7208 | SoyCyc9 | superpathway of pyrimidine nucleobases salvage | Plant Metabolic Network | ISS | |
| PWYQT-4445 | SoyCyc9 | pyrimidine salvage pathway | Plant Metabolic Network | ISS | |
| GN7V-65555 | SoyCyc9-rxn | uracil phosphoribosyltransferase | Plant Metabolic Network | ISS |
|
Glyma.07G168300 not represented in the dataset |
Glyma.07G168300 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma07g24960 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.07g168300.1 sequence-type=CDS polypeptide=Glyma.07g168300.1.p locus=Glyma.07g168300 ID=Glyma.07g168300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGATTCTAAAAGAAACGACATCGATTGACTACGTAATGGAGGCAACATCTAGGTCTCACTTCTCCGCCCTGAGACTCAATGGAGTTTCTGGAGATACTGCCTCGGGCAAAACCACCGTCTGCGATATGATCATTCAACAACTCCATGATCACCGTGTTGTCCTCGTAAATCAGGACTCATTTTATCACTGGTTGAATCCTGAAGAATTGGAACGTGTTCACGAGTACTATTTCGACCACCGTGATGCTTTTGACACGGAGCAGTTGTTAAAGTGCACGAGGAAGCTCATCAGTGGCCAGGGCGTGCATGTTCCCATTTATGACTTCAAGAAGCAGCAACACTCTTCTGATAGTTTTCGCCAGGTTTTCGATTGA
>Glyma.07g168300.1.p sequence-type=predicted peptide transcript=Glyma.07g168300.1 locus=Glyma.07g168300 ID=Glyma.07g168300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MILKETTSIDYVMEATSRSHFSALRLNGVSGDTASGKTTVCDMIIQQLHDHRVVLVNQDSFYHWLNPEELERVHEYYFDHRDAFDTEQLLKCTRKLISGQGVHVPIYDFKKQQHSSDSFRQVFD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||