Glyma.07G129900

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.07G129900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.07G129900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.07G129900

Feature Type:	gene_model
Chromosome:	Gm07
Start:	15420011
stop:	15421954
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.07G129900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G06925.1	AT	Phospholipase A2 family protein	JGI	N/A	IEA
GO:0006644	GO-bp	phospholipid metabolic process	EnsemblGenomes	N/A	IEA
GO:0016042	GO-bp	lipid catabolic process	EnsemblGenomes	N/A	IEA
GO:0050482	GO-bp	arachidonic acid secretion	EnsemblGenomes	N/A	IEA
GO:0005576	GO-cc	extracellular region	EnsemblGenomes	N/A	IEA
GO:0004623	GO-mf	phospholipase A2 activity	EnsemblGenomes	N/A	IEA
GO:0005509	GO-mf	calcium ion binding	EnsemblGenomes	N/A	IEA
LIPASYN-PWY	SoyCyc9	phospholipases	Plant Metabolic Network		ISS
PWY-6803	SoyCyc9	phosphatidylcholine acyl editing	Plant Metabolic Network		ISS
PWY-7416	SoyCyc9	phospholipid remodeling (phosphatidylcholine, yeast)	Plant Metabolic Network		ISS
GN7V-47732	SoyCyc9-rxn	phospholipase A₂	Plant Metabolic Network		ISS

Expression Patterns of Glyma.07G129900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.07G129900 not represented in the dataset	Glyma.07G129900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.07G129900

Paralog	Evidence	Comments
Glyma.01g002400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.07G129900 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.07g129900	Wm82.a4.v1	ISS	As supplied by JGI
Glyma07g15580	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.07G129900

Limit To All Plant Sequences

>Glyma.07g129900.1 sequence-type=CDS polypeptide=Glyma.07g129900.1.p locus=Glyma.07g129900 ID=Glyma.07g129900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTTCCAGCCCCCTCATTCAAGTATGTTCTCTTCTTTTGTTGTACTTTTGCCTTTAACTTGTTATCCACTCCTGTCCGTGCCCTCAACATAGGAGCTGAAACCACTGGAGTCGCTGTCTCTGTGGGCAAAGAGTGCAGTAGACAATGTGAGTCAAGTTTCTGCTCAGTGCCTCCATTATTGAGATATGGCAAGTACTGTGGACTTTTGTATAGTGGATGCCCTGGAGAAAGACCTTGTGATGGCCTTGACGCTTGTTGTATGAAGCATGATCAATGTGTGTCAGCCAAAAACAATGACTACCTAAGCCAAGAGTGCAGCCAAACATTCATAAATTGTATGAATAACTTTAAGAACTCAAAGGCTCCTACATTCAAAGGAAACACGTGCGATGTGGATGATGTTATTGAAGTTATACATGTTGTGATGGAAGCTGCTTTACTGGCTGGAAGAGTTCTCCACAAGCCATAG

Predicted protein sequences of Glyma.07G129900

Limit To All Plant Sequences

>Glyma.07g129900.1.p sequence-type=predicted peptide transcript=Glyma.07g129900.1 locus=Glyma.07g129900 ID=Glyma.07g129900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVPAPSFKYVLFFCCTFAFNLLSTPVRALNIGAETTGVAVSVGKECSRQCESSFCSVPPLLRYGKYCGLLYSGCPGERPCDGLDACCMKHDQCVSAKNNDYLSQECSQTFINCMNNFKNSKAPTFKGNTCDVDDVIEVIHVVMEAALLAGRVLHKP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain