|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G67980.1 | AT | caffeoyl-CoA 3-O-methyltransferase | JGI | N/A | IEA |
| GO:0032259 | GO-bp | methylation | EnsemblGenomes | N/A | IEA |
| GO:0008171 | GO-mf | O-methyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0008171 | GO-mf | O-methyltransferase activity | JGI | N/A | IEA |
| PTHR10509 | Panther | O-METHYLTRANSFERASE-RELATED | JGI | N/A | IEA |
| PF01596 | PFAM | O-methyltransferase | JGI | N/A | IEA |
| PWY-5391 | SoyCyc9 | syringetin biosynthesis | Plant Metabolic Network | ISS | |
| PWY-6064 | SoyCyc9 | methylquercetin biosynthesis | Plant Metabolic Network | ISS | |
| PWY-6199 | SoyCyc9 | quercetin sulfate biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7157 | SoyCyc9 | eupatolitin 3-O-glucoside biosynthesis | Plant Metabolic Network | ISS | |
| PWY-7495 | SoyCyc9 | gossypetin metabolism | Plant Metabolic Network | ISS | |
| PWY-7498 | SoyCyc9 | phenylpropanoids methylation (ice plant) | Plant Metabolic Network | ISS | |
| GN7V-62489 | SoyCyc9-rxn | gossypetin 8-O-methyltransferase | Plant Metabolic Network | ISS |
|
Glyma.07G127700 not represented in the dataset |
Glyma.07G127700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma07g15341 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.07g127700.1 sequence-type=CDS polypeptide=Glyma.07g127700.1.p locus=Glyma.07g127700 ID=Glyma.07g127700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTGTTGGGTGCAGCCTGCAAATGAAGGATCTTATGACTTTGCCTTCATTGATGCTGACAAGGAGAACTATGTGAACTACCATGAGAAGCTTATAAAACTGGTCAAGATTGGGGGGCTACTTGTATATGACAACACACTGTGGGGTGGACGCGTTAGCTGGCCTGAAGACAAAGTTCCACCACACTTCAGACCAGGGAGGGACGCAGCAATTGAATTTAACAAAACAATCACAAACGATTCTCGTGTTGAATTTGCTCTTACTTCCGTAGGGGATGGTCTCAATATTTGTAGGCGCATTGCTTGA
>Glyma.07g127700.1.p sequence-type=predicted peptide transcript=Glyma.07g127700.1 locus=Glyma.07g127700 ID=Glyma.07g127700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MCWVQPANEGSYDFAFIDADKENYVNYHEKLIKLVKIGGLLVYDNTLWGGRVSWPEDKVPPHFRPGRDAAIEFNKTITNDSRVEFALTSVGDGLNICRRIA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||