SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.07G126100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.07G126100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.07G126100

Feature Type:gene_model
Chromosome:Gm07
Start:15058436
stop:15059301
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.07G126100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G19800.1AT myo-inositol oxygenase 2 JGI N/AIEA
GO:0019310GO-bp inositol catabolic process EnsemblGenomesN/AIEA
GO:0019310GO-bp inositol catabolic process JGI N/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm JGI N/AIEA
GO:0005506GO-mf iron ion binding EnsemblGenomesN/AIEA
GO:0005506GO-mf iron ion binding JGI N/AIEA
GO:0050113GO-mf inositol oxygenase activity EnsemblGenomesN/AIEA
GO:0050113GO-mf inositol oxygenase activity JGI N/AIEA
PTHR12588Panther MYOINOSITOL OXYGENASE JGI N/AIEA
PF05153PFAM Family of unknown function (DUF706) JGI N/AIEA
PWY-4841SoyCyc9 UDP-α-D-glucuronate biosynthesis (from myo-inositol) Plant Metabolic Network ISS
GN7V-50408SoyCyc9-rxn inositol oxygenase Plant Metabolic Network ISS

Expression Patterns of Glyma.07G126100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.07G126100 not represented in the dataset
Glyma.07G126100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.



Coding sequences of Glyma.07G126100
>Glyma.07g126100.1 sequence-type=CDS polypeptide=Glyma.07g126100.1.p locus=Glyma.07g126100 ID=Glyma.07g126100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAATTCATATGGTCACTCCTTCAGAAATTATTATGGTGAAAGCGAAAGGCAAAAGTTTGTGGAGGAACTCTACCAACGACAACACATGAACCAAACATATAATTTTGCTAAGAAGATGAGGGAGGAGTATGGAAAATTGAATAAAGTGAAAATGAGTATATGGGAATGTTGTGAGATGCTTGACAAAATTGTGGATGTCAGTGATCCTGATTTAGAAGAATCTCAAATTCAACATGCCTTGCAGACAGTTGTTAGAAAGGACTATTTCGGAAAGGCTCTTATCCTTCCAAGTTTTGGTGGGCTTCCTCAATGGGCTGTTGTTGGTGAGAGTTGCCCACTAATTAAACATATATAG
Predicted protein sequences of Glyma.07G126100
>Glyma.07g126100.1.p sequence-type=predicted peptide transcript=Glyma.07g126100.1 locus=Glyma.07g126100 ID=Glyma.07g126100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MNSYGHSFRNYYGESERQKFVEELYQRQHMNQTYNFAKKMREEYGKLNKVKMSIWECCEMLDKIVDVSDPDLEESQIQHALQTVVRKDYFGKALILPSFGGLPQWAVVGESCPLIKHI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo