|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G14710.1 | AT | RmlC-like cupins superfamily protein | JGI | N/A | IEA |
| GO:0006555 | GO-bp | methionine metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
| GO:0010309 | GO-mf | acireductone dioxygenase [iron(II)-requiring] activity | EnsemblGenomes | N/A | IEA |
| GO:0010309 | GO-mf | acireductone dioxygenase [iron(II)-requiring] activity | JGI | N/A | IEA |
| KOG2107 | KOG | Uncharacterized conserved protein, contains double-stranded beta-helix domain | JGI | N/A | IEA |
| PTHR23418 | Panther | ACIREDUCTONE DIOXYGENASE | JGI | N/A | IEA |
| PF03079 | PFAM | ARD/ARD' family | JGI | N/A | IEA |
| PWY-4361 | SoyCyc9 | S-methyl-5-thio-α-D-ribose 1-phosphate degradation | Plant Metabolic Network | ISS | |
| PWY-7270 | SoyCyc9 | L-methionine salvage cycle II (plants) | Plant Metabolic Network | ISS | |
| PWY-7528 | SoyCyc9 | L-methionine salvage cycle I (bacteria and plants) | Plant Metabolic Network | ISS | |
| GN7V-62057 | SoyCyc9-rxn | acireductone dioxygenase [iron(II)-requiring] | Plant Metabolic Network | ISS |
|
Glyma.07G116400 not represented in the dataset |
Glyma.07G116400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma07g13585 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.07g116400.1 sequence-type=CDS polypeptide=Glyma.07g116400.1.p locus=Glyma.07g116400 ID=Glyma.07g116400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAATCGACATCTGCCATTAATAACATTGGATGATAGTGATGAAGATCAAACACTCCCCCACCACAAAGCACCTAAGGAGTTTGTCTCGTTGGACCAACTTGTTGAACTTGGAGTCCTTAGTTGGAAACTAGATGCTGATAACCATGGAAATGATCCAGAGCTGAAGAAGATTCATGAAGAGCATGGTTACACCTACATGCATTTTCACACTGATGAGGAGATCCTCTTTTGTGCTGCTGGAAGCCGCTATTGTGATGTTAAGGATCACAATGATGCTTGGATTCGTGAGTGGGTCAAGAAAGGAGGAATGATCATCTTACCTGTCAGAATTTATCATCACTTTACGCTAGATGAGAGCAACTACATTAAGGTATTGATTGCATATTTACAAGTATTTTATGGCGAAACTGCTACTTTTTTCTGGTTCTAA
>Glyma.07g116400.1.p sequence-type=predicted peptide transcript=Glyma.07g116400.1 locus=Glyma.07g116400 ID=Glyma.07g116400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MNRHLPLITLDDSDEDQTLPHHKAPKEFVSLDQLVELGVLSWKLDADNHGNDPELKKIHEEHGYTYMHFHTDEEILFCAAGSRYCDVKDHNDAWIREWVKKGGMIILPVRIYHHFTLDESNYIKVLIAYLQVFYGETATFFWF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||