SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.07G106200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.07G106200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.07G106200

Feature Type:gene_model
Chromosome:Gm07
Start:10309616
stop:10313306
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.07G106200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73820.1AT Ssu72-like family protein JGI N/AIEA
GO:0006369GO-bp termination of RNA polymerase II transcription EnsemblGenomesN/AIEA
GO:0006378GO-bp mRNA polyadenylation EnsemblGenomesN/AIEA
GO:0006397GO-bp mRNA processing EnsemblGenomesN/AIEA
GO:0006397GO-bp mRNA processing JGI N/AIEA
GO:0070940GO-bp dephosphorylation of RNA polymerase II C-terminal domain EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus JGI N/AIEA
GO:0005847GO-cc mRNA cleavage and polyadenylation specificity factor complex EnsemblGenomesN/AIEA
GO:0004721GO-mf phosphoprotein phosphatase activity EnsemblGenomesN/AIEA
GO:0004721GO-mf phosphoprotein phosphatase activity JGI N/AIEA
GO:0008420GO-mf CTD phosphatase activity EnsemblGenomesN/AIEA
KOG2424 KOG Protein involved in transcription start site selection JGI N/AIEA
PTHR20383Panther FAMILY NOT NAMED JGI N/AIEA
PF04722PFAM Ssu72-like protein JGI N/AIEA

Expression Patterns of Glyma.07G106200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.07G106200 not represented in the dataset
Glyma.07G106200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.07G106200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.07g106200 Wm82.a4.v1ISS As supplied by JGI
Glyma07g11980 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.07G106200
>Glyma.07g106200.1 sequence-type=CDS polypeptide=Glyma.07g106200.1.p locus=Glyma.07g106200 ID=Glyma.07g106200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAGTTTCGGTACGCGATGGTGTGTTCTTCGAACCAGAACCGAAGCATGGAGGCTCATTTCCTGCTCAAGAGGCAGGGCTTCGACGTGTCCTCGTACGGCACCGGTGCCCACGTTAAGCTCCCTGGTCCTTCCCTCAGAGAACCCAATGTCTACGACTTCGGAACCCCCTACAAGCACATGATCGAGGACCTCCGCAGAAAAGACCCCGATCTCTACAAACGAAACGGAATCTTTCCAATGCTTAAAAGAAATTCAACAGTCAAATTAGCACCGCAACGGTGGCAAGAAAATGCCGCTGATGGTTCCTTTGATGTGGTAGTTACATTTGAAGAAAAAGTGTTTGATATGGTTATTGAAGATCTCCATAATAGAGATCATGCTTTATTGAAAACTGTGCTGGTAATCAACTTGGAGGTAAAAGATAACCACGATGAAGCAGCCGTGGGAGCAAGGCTTACTTTAGATCTCTGTCGGGAGATTGAAGCTGCTGAATCATGGGAAGAGTCAATTGATGAAATTATTGCTGGTTTTGAGAATAAACATCGGCGGAAGCTTTTGTACAGCATCTCCTTCTACTAA
Predicted protein sequences of Glyma.07G106200
>Glyma.07g106200.1.p sequence-type=predicted peptide transcript=Glyma.07g106200.1 locus=Glyma.07g106200 ID=Glyma.07g106200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKFRYAMVCSSNQNRSMEAHFLLKRQGFDVSSYGTGAHVKLPGPSLREPNVYDFGTPYKHMIEDLRRKDPDLYKRNGIFPMLKRNSTVKLAPQRWQENAADGSFDVVVTFEEKVFDMVIEDLHNRDHALLKTVLVINLEVKDNHDEAAVGARLTLDLCREIEAAESWEESIDEIIAGFENKHRRKLLYSISFY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo