Report for Sequence Feature Glyma.06g310900
| Feature Type: | gene_model |
| Chromosome: | Gm06 |
| Start: | 49493205 |
| stop: | 49494016 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.06g310900
Gene model name correspondences to Glyma.06g310900 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma06g46781 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.06g310900
>Glyma.06g310900.1 sequence-type=CDS polypeptide=Glyma.06g310900.1.p locus=Glyma.06g310900 id=Glyma.06g310900.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGATACTCCCTCTGGAATCAAGGACTCAATTCCTGCTTGGATTAAATTTGCTGTACAGGCTCCCGGTGAAATTCCATACAGCGGAATATACTATGATCCCCTAGAAGAGAACTCATGCGTTGCCCCCCTAATAGAGGACCTGAAGGTTCGATGCGAACGACGACGGAAAAATCTCCTCGGTGTAAGCAGCAATTTTGGGGGGTCATACATGCATATATCACATGATTGA
Predicted protein sequences of Glyma.06g310900
>Glyma.06g310900.1.p sequence-type=predicted peptide transcript=Glyma.06g310900.1 locus=Glyma.06g310900 id=Glyma.06g310900.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MDTPSGIKDSIPAWIKFAVQAPGEIPYSGIYYDPLEENSCVAPLIEDLKVRCERRRKNLLGVSSNFGGSYMHISHD*