Glyma.06g307200

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.06g307200

Feature Type:	gene_model
Chromosome:	Gm06
Start:	49609833
stop:	49613825
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.06g307200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G42570.1	AT	B-cell receptor-associated 31-like	JGI	N/A	IEA
GO:0006886	GO-bp	intracellular protein transport	EnsemblGenomes	N/A	IEA
GO:0006886	GO-bp	intracellular protein transport	JGI	N/A	IEA
GO:0006888	GO-bp	ER to Golgi vesicle-mediated transport	EnsemblGenomes	N/A	IEA
GO:0070973	GO-bp	protein localization to endoplasmic reticulum exit site	EnsemblGenomes	N/A	IEA
GO:0005783	GO-cc	endoplasmic reticulum	EnsemblGenomes	N/A	IEA
GO:0005783	GO-cc	endoplasmic reticulum	JGI	N/A	IEA
GO:0005789	GO-cc	endoplasmic reticulum membrane	EnsemblGenomes	N/A	IEA
GO:0016020	GO-cc	membrane	EnsemblGenomes	N/A	IEA
GO:0016021	GO-cc	integral component of membrane	EnsemblGenomes	N/A	IEA
GO:0016021	GO-cc	integral component of membrane	JGI	N/A	IEA
KOG1962	KOG	B-cell receptor-associated protein and related proteins	JGI	N/A	IEA
PTHR12701	Panther	BCR-ASSOCIATED PROTEIN, BAP	JGI	N/A	IEA
PTHR12701:SF1	Panther		JGI	N/A	IEA
PF05529	PFAM	B-cell receptor-associated protein 31-like	JGI	N/A	IEA

Proteins Associated with Glyma.06g307200

Locus	Gene Symbol	Protein Name
	bZIP56	Basic leucine zipper transcription factor-like protein gene 56

Expression Patterns of Glyma.06g307200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.06g307200

Paralog	Evidence	Comments
Glyma.12g097500	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.06g307200 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma06g46370	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.06g307200

Limit To All Plant Sequences

>Glyma.06g307200.1 sequence-type=CDS polypeptide=Glyma.06g307200.1.p locus=Glyma.06g307200 ID=Glyma.06g307200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTGCAGCTACTCTACACTGCGATTTTCTTCGAAATGATTCTCATTCTCACCCTTGTCTTCAAGACCCCACTGAGAAAACTCGTCATCGTTTCCCTCGATCGTGTGAAGCGCGGTCGCGGCCCCGTGGTGGTTTCCACCGTGGGCGCCACATTGGTGGTGGTTCTCGCGTCGAGCCTCTACAGCATGGCCAAGATCCAGCAACGCACCCTCGAGGCCGGCATAGTCAACCCCACCGACCAAGTCCTCATGTCCAAGCACATGCTCGAGGCTTCTCTCATGGGGTTTGTACTGTTCCTCTCTCTGATGATTGATAGACTGCACCATTACATAAGAGAGCTTCGGTCACTCAGGAAGACCATGGAAGCCATTAAGAAACAAAGCCGAAGTTTTGAAGATGGTAAAAATGGCAATTTAGAGGAACATAAAGCATTGAATGAAGAAATTACCACATTGAAGTCTAAAATTAAGAAACTAGAATCTGAATGTGAGGCAAAAGGAAATCAAGCTAAGACTTTGGAAACTGAAGTAGAGGCTCTTAAAAAGCAATCCGAAGGGTTCCTTATGGAATATGATCGCCTCTTGGAAGACAATCAGAGTCTTAGGAGTCAGTTGCAGGCCATTGAGCAGAACCCTTTGTAA

Predicted protein sequences of Glyma.06g307200

Limit To All Plant Sequences

>Glyma.06g307200.1.p sequence-type=predicted peptide transcript=Glyma.06g307200.1 locus=Glyma.06g307200 ID=Glyma.06g307200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLQLLYTAIFFEMILILTLVFKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLVVVLASSLYSMAKIQQRTLEAGIVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNLEEHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEGFLMEYDRLLEDNQSLRSQLQAIEQNPL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain