|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G16030.1 | AT | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | JGI | N/A | IEA |
| GO:0008152 | GO-bp | metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0008152 | GO-bp | metabolic process | JGI | N/A | IEA |
| GO:0032259 | GO-bp | methylation | EnsemblGenomes | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
| GO:0008168 | GO-mf | methyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0008168 | GO-mf | methyltransferase activity | JGI | N/A | IEA |
| GO:0008757 | GO-mf | S-adenosylmethionine-dependent methyltransferase activity | EnsemblGenomes | N/A | IEA |
| PF08241 | PFAM | Methyltransferase domain | JGI | N/A | IEA |
| PWY-1422 | SoyCyc9 | vitamin E biosynthesis (tocopherols) | Plant Metabolic Network | ISS | |
| PWY-1581 | SoyCyc9 | plastoquinol-9 biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-5864 | SoyCyc9 | superpathway of plastoquinol biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-65946 | SoyCyc9-rxn | 2-methyl-6-phytyl-1,4-benzoquinone methyltransferase | Plant Metabolic Network | ISS |
|
Glyma.06g301100 not represented in the dataset |
Glyma.06g301100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.12g103300 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma06g45655 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.06g301100.1 sequence-type=CDS polypeptide=Glyma.06g301100.1.p locus=Glyma.06g301100 ID=Glyma.06g301100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTGTAAAGAAGCCGCACCTCCGCTTCCCCAAATCCACTGCGACTTCTCCTCCACGCGCCCCCACGTCCCCGCCAAGAACCGCGCCCTGCGCGTTCAGTCCACGCGCCTCTGGGCCGCCAAGGTCCTCTCCTTCTCCCTCCTCTTCCGCGACCACCTCCTCCTCCGCGCCGCCGCCTTCAACCACTCCTGCGTCCTCTGCGTCTCCGCTGGCGCCGGCCAGGAGGTCGCCGCGCTCCGCCTCCTCGGCATCGACGACGTCACCGGCGTCGAGATCCTCGAGTCCCCGCCGCTCGTCCGCCGCGCCGATCCGCACAACCTCCCGTTCTTCGACGGCGTGTTCGACCTCGCCTTCACCGCGCGGTTCGACGAGGCGCTGTTTGCCGCCGAGATGGAGCGCGTGATCCGGCCTGGCGGCGCGTGCGTTGTTCTCGTGGCGGAGTCTGGGGAGGATGAGGTGAGGGAGGTTGTTGGATTATTTAGGAATTCGAGGCTTGTTAGGTGGAGTAATGTTTCTGACTGGAATGAGAATGGCCAGTGTTCTTTTGAGAACTAG
>Glyma.06g301100.1.p sequence-type=predicted peptide transcript=Glyma.06g301100.1 locus=Glyma.06g301100 ID=Glyma.06g301100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MCKEAAPPLPQIHCDFSSTRPHVPAKNRALRVQSTRLWAAKVLSFSLLFRDHLLLRAAAFNHSCVLCVSAGAGQEVAALRLLGIDDVTGVEILESPPLVRRADPHNLPFFDGVFDLAFTARFDEALFAAEMERVIRPGGACVVLVAESGEDEVREVVGLFRNSRLVRWSNVSDWNENGQCSFEN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||