Report for Sequence Feature Glyma.06g284100
Feature Type: | gene_model |
Chromosome: | Gm06 |
Start: | 46845530 |
stop: | 46845811 |
Source: | JGI |
Version: | Wm82.a4.v1 |
High confidence: | yes |
|
|
Annotations for Glyma.06g284100
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
AT2G31085.1 | AT |
CLE6 |
JGI | N/A | IEA |
PTHR36016 | PantherFam |
CLAVATA3/ESR (CLE)-RELATED PROTEIN 7 |
JGI | N/A | IEA |
Proteins Associated with Glyma.06g284100
Locus | Gene Symbol | Protein Name |
| RIC2 | CLE-related protein RIC2 |
Gene model name correspondences to Glyma.06g284100 Gene Call Version Wm82.a4.v1
Corresponding Name | Annotation Version | Evidence | Comments |
Glyma06g43681 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.06g284100
>Glyma.06g284100.1 sequence-type=CDS polypeptide=Glyma.06g284100.1.p locus=Glyma.06g284100 id=Glyma.06g284100.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGGAAATACAAGTGCAACCCTAGTGCCCATACTTGCCCTAATCATGTTCTCTACATTCTTCATGACTTTGCAAGCTCGTAGTCTCCATGGCCACAATCCATTATTCGCTCACAAAAAAGTTGTTGACATCCAAAACTTTCTCCACAAATCGGGTATTCACCTATCAAAGCGTGTGCGTATTCCATTTGGTGATGATCTCCCACTAGCACCTGCAGATAGACTTGCACCAGGAGGACCAGATCCTCAGCATAATGTGAGAGCTCCACCACGCAAGCCATAG
Predicted protein sequences of Glyma.06g284100
>Glyma.06g284100.1.p sequence-type=predicted peptide transcript=Glyma.06g284100.1 locus=Glyma.06g284100 id=Glyma.06g284100.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MGNTSATLVPILALIMFSTFFMTLQARSLHGHNPLFAHKKVVDIQNFLHKSGIHLSKRVRIPFGDDLPLAPADRLAPGGPDPQHNVRAPPRKP*