SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.06g242400

Feature Type:gene_model
Chromosome:Gm06
Start:40289961
stop:40290668
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.06g242400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G52560.1AT UDP-sugar pyrophosphorylase JGI N/AIEA
GO:0009226GO-bp nucleotide-sugar biosynthetic process EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0070569GO-mf uridylyltransferase activity EnsemblGenomesN/AIEA
PTHR11952Panther UDP- GLUCOSE PYROPHOSPHORYLASE JGI N/AIEA
PTHR11952:SF2Panther LD24639P JGI N/AIEA
PWY-3801SoyCyc9 sucrose degradation II (sucrose synthase) Plant Metabolic Network ISS
PWY-3821SoyCyc9 D-galactose detoxification Plant Metabolic Network ISS
PWY-4841SoyCyc9 UDP-α-D-glucuronate biosynthesis (from myo-inositol) Plant Metabolic Network ISS
PWY-6527SoyCyc9 stachyose degradation Plant Metabolic Network ISS
PWY-7238SoyCyc9 sucrose biosynthesis II Plant Metabolic Network ISS
PWY-7343SoyCyc9 UDP-α-D-glucose biosynthesis I Plant Metabolic Network ISS
PWY-7345SoyCyc9 superpathway of anaerobic sucrose degradation Plant Metabolic Network ISS
PWYQT-4466SoyCyc9 superpathway of sucrose and starch metabolism I (non-photosynthetic tissue) Plant Metabolic Network ISS
SUCSYN-PWYSoyCyc9 sucrose biosynthesis I (from photosynthesis) Plant Metabolic Network ISS
UDPNACETYLGALSYN-PWYSoyCyc9 UDP-N-acetyl-D-glucosamine biosynthesis II Plant Metabolic Network ISS
GN7V-56778SoyCyc9-rxn glucuronate-1-phosphate uridylyltransferase Plant Metabolic Network ISS

Expression Patterns of Glyma.06g242400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.06g242400 not represented in the dataset
Glyma.06g242400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.06g242400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma06g37151 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.06g242400
>Glyma.06g242400.1 sequence-type=CDS polypeptide=Glyma.06g242400.1.p locus=Glyma.06g242400 ID=Glyma.06g242400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTTCCTCCCTCGACGACAACTTCAACCTTCTCTCTCCTGAACAGCAAGAGCTGGTGAAGGTGCTACTGGATAACGGCCAAGAGCACCTGTTTCGCGATTGGCCAGCTCCCGGCGTCGATGATAACCACAAGAAAGCGTTCTTTGACCAGTTGACTCAACTCGATTCGAGTTACCCTGGTGGTCTGGAATCATACATCAAAAACGCTAAACGGCTCTTGGCCGATTCTAAGGCTGGCATAAACCCTTTCGACGGCTTTACACCTTCCGTTCCAACGGGTGAGACTTTGGCATTTGGTGATGAGAGCTACATCAAATTTGAGGAAGCAGGTGTACTTGAAGCTCGACTGCTTTTGTTCTTGTTGCCGGTGGTCTTGGCAAGCGTTTAG
Predicted protein sequences of Glyma.06g242400
>Glyma.06g242400.1.p sequence-type=predicted peptide transcript=Glyma.06g242400.1 locus=Glyma.06g242400 ID=Glyma.06g242400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASSLDDNFNLLSPEQQELVKVLLDNGQEHLFRDWPAPGVDDNHKKAFFDQLTQLDSSYPGGLESYIKNAKRLLADSKAGINPFDGFTPSVPTGETLAFGDESYIKFEEAGVLEARLLLFLLPVVLASV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo