Glyma.06g206500

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.06g206500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.06g206500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.06g206500

Feature Type:	gene_model
Chromosome:	Gm06
Start:	19823329
stop:	19824349
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.06g206500

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G73960.1	AT	TBP-associated factor 2	JGI	N/A	IEA
GO:0045944	GO-bp	positive regulation of transcription by RNA polymerase II	EnsemblGenomes	N/A	IEA
GO:0051123	GO-bp	RNA polymerase II transcriptional preinitiation complex assembly	EnsemblGenomes	N/A	IEA
GO:0005669	GO-cc	transcription factor TFIID complex	EnsemblGenomes	N/A	IEA
GO:0001075	GO-mf	transcription factor activity, RNA polymerase II core promoter sequence-specific binding involved in preinitiation complex assembly	EnsemblGenomes	N/A	IEA
GO:0001129	GO-mf	RNA polymerase II transcription factor activity, TBP-class protein binding, involved in preinitiation complex assembly	EnsemblGenomes	N/A	IEA
GO:0003682	GO-mf	chromatin binding	EnsemblGenomes	N/A	IEA
GO:0043565	GO-mf	sequence-specific DNA binding	EnsemblGenomes	N/A	IEA
GO:0044212	GO-mf	transcription regulatory region DNA binding	EnsemblGenomes	N/A	IEA
PTHR15137	Panther	TRANSCRIPTION INITIATION FACTOR TFIID	JGI	N/A	IEA
PTHR15137:SF1	Panther		JGI	N/A	IEA

Expression Patterns of Glyma.06g206500

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.06g206500 not represented in the dataset	Glyma.06g206500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.06g206500 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma06g22804	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.06g206500

Limit To All Plant Sequences

>Glyma.06g206500.1 sequence-type=CDS polypeptide=Glyma.06g206500.1.p locus=Glyma.06g206500 ID=Glyma.06g206500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATCAACTTTGTGGCTCATGTCATTTTTATCCTCTTATTTTTTCAGTACAATGACAACAATGAGAACCCTTACTCAGATTTGGTGAGCTTGAGTTTGGGCAATAGTATTCTCTTATTGTCATCACTCCTCAAATGCATTGAATGGCTTCTACAATTTGATAGTCTCATGCCAAGCTACAATGGAATCTTGACTATTAGTTGTATCCGGACATTGACCCAGATTGCATTAAAAGCTTTCATGGTTCATTCCGCTTACATAAAGGAATTGTGCCAAGTTAGAATTGAAGCATGTATAGCACTCCTTGATCTTGAATTCCAATACAAGGGCATGGATTCAACTTTGCTTTTATTTATCAAATACATAGAAGATTTTGCATTCCTTAAGAGGTTGTAA

Predicted protein sequences of Glyma.06g206500

Limit To All Plant Sequences

>Glyma.06g206500.1.p sequence-type=predicted peptide transcript=Glyma.06g206500.1 locus=Glyma.06g206500 ID=Glyma.06g206500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MINFVAHVIFILLFFQYNDNNENPYSDLVSLSLGNSILLLSSLLKCIEWLLQFDSLMPSYNGILTISCIRTLTQIALKAFMVHSAYIKELCQVRIEACIALLDLEFQYKGMDSTLLLFIKYIEDFAFLKRL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain