Report for Sequence Feature Glyma.06g157900
| Feature Type: | gene_model |
| Chromosome: | Gm06 |
| Start: | 12911636 |
| stop: | 12913397 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.06g157900
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT5G63610.1 | AT |
ATCDK8,CDKE;1,HEN3 |
JGI | N/A | IEA |
| 2.7.11.22 | EC |
cyclin-dependent kinase |
JGI | N/A | IEA |
| 2.7.11.23 | EC |
[RNA-polymerase]-subunit kinase |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.06g157900 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma06g16500 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.06g157900
>Glyma.06g157900.1 sequence-type=CDS polypeptide=Glyma.06g157900.1.p locus=Glyma.06g157900 id=Glyma.06g157900.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGCTCAGTGCACTTGTACCCTGCCAACCTGGAGAGACATTTGTGAATTATCCCACGTGTCCAGTGGATACAACAACAGATTTTGAAGGGGCAGCCAACATGCAACCTTCACAGACGACCTCATTATTTTATTGCAGTCAAAGGTTTATTGCATTGAGCACAGGAAACTGGATGCTATTATAA
Predicted protein sequences of Glyma.06g157900
>Glyma.06g157900.1.p sequence-type=predicted peptide transcript=Glyma.06g157900.1 locus=Glyma.06g157900 id=Glyma.06g157900.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MLSALVPCQPGETFVNYPTCPVDTTTDFEGAANMQPSQTTSLFYCSQRFIALSTGNWMLL*