SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.06g155900

Feature Type:gene_model
Chromosome:Gm06
Start:12793591
stop:12796632
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.06g155900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09250.1AT ssDNA-binding transcriptional regulator JGI N/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0060261GO-bp positive regulation of transcription initiation from RNA polymerase II promoter EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005667GO-cc transcription factor complex EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding JGI N/AIEA
GO:0003713GO-mf transcription coactivator activity EnsemblGenomesN/AIEA
GO:0003713GO-mf transcription coactivator activity JGI N/AIEA
KOG2712 KOG Transcriptional coactivator JGI N/AIEA
PTHR13215Panther RNA POLYMERASE II TRANSCRIPTIONAL COACTIVATOR JGI N/AIEA
PF02229PFAM Transcriptional Coactivator p15 (PC4) JGI N/AIEA

Expression Patterns of Glyma.06g155900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.06g155900
ParalogEvidenceComments
Glyma.04g210100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.06g155900 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma06g16250 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.06g155900
>Glyma.06g155900.1 sequence-type=CDS polypeptide=Glyma.06g155900.1.p locus=Glyma.06g155900 ID=Glyma.06g155900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCTGGAAAAGCGAAGAGGAGAGATGACGACGGTGCTTCCGACGCCGACTCTGAAGGCCACGCGCCGCCCAAGAAGTCCCTCAAGAAGGATTCCGATGACGATCCCGACTCTATTACCGTTTGCGAGATTTCGAAGAACAGGAGGGTTGCCGTGAGGAACTGGAAAGGCAGCATTATGGTTGACATTCGCGAGTTTTACGTCAAAGATGGCAAGCAATTGCCTGGCAGAAAAGGTATCTCTTTGACCATGGATCAGTGGAATGTGCTTCGTAATCATGTTGAAGAAATTGACAAGGCAATTAATGAGAATTCTTAG
Predicted protein sequences of Glyma.06g155900
>Glyma.06g155900.1.p sequence-type=predicted peptide transcript=Glyma.06g155900.1 locus=Glyma.06g155900 ID=Glyma.06g155900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSGKAKRRDDDGASDADSEGHAPPKKSLKKDSDDDPDSITVCEISKNRRVAVRNWKGSIMVDIREFYVKDGKQLPGRKGISLTMDQWNVLRNHVEEIDKAINENS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo