Report for Sequence Feature Glyma.06g134100
| Feature Type: | gene_model |
| Chromosome: | Gm06 |
| Start: | 10971058 |
| stop: | 10971439 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.06g134100
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT5G53588.1 | AT |
CPuORF50 |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.06g134100 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.06g134100
>Glyma.06g134100.1 sequence-type=CDS polypeptide=Glyma.06g134100.1.p locus=Glyma.06g134100 id=Glyma.06g134100.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAGCAACATCCCAAGATCTCTCACCGACTCTTCCCTAACCCTCTTCAACCTCGCCATATCATCCTCTGATCCCTGGCCTTTCTCACTCGTTTTCTTATAA
Predicted protein sequences of Glyma.06g134100
>Glyma.06g134100.1.p sequence-type=predicted peptide transcript=Glyma.06g134100.1 locus=Glyma.06g134100 id=Glyma.06g134100.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MSNIPRSLTDSSLTLFNLAISSSDPWPFSLVFL*