|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G24570.1 | AT | dicarboxylate carrier 2 | JGI | N/A | IEA |
GO:0006839 | GO-bp | mitochondrial transport | EnsemblGenomes | N/A | IEA |
GO:0008272 | GO-bp | sulfate transport | EnsemblGenomes | N/A | IEA |
GO:0015709 | GO-bp | thiosulfate transport | EnsemblGenomes | N/A | IEA |
GO:0015729 | GO-bp | oxaloacetate transport | EnsemblGenomes | N/A | IEA |
GO:0035435 | GO-bp | phosphate ion transmembrane transport | EnsemblGenomes | N/A | IEA |
GO:0071422 | GO-bp | succinate transmembrane transport | EnsemblGenomes | N/A | IEA |
GO:0071423 | GO-bp | malate transmembrane transport | EnsemblGenomes | N/A | IEA |
GO:1902356 | GO-bp | oxaloacetate(2-) transmembrane transport | EnsemblGenomes | N/A | IEA |
GO:1902358 | GO-bp | sulfate transmembrane transport | EnsemblGenomes | N/A | IEA |
GO:0005743 | GO-cc | mitochondrial inner membrane | EnsemblGenomes | N/A | IEA |
GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
GO:0031966 | GO-cc | mitochondrial membrane | EnsemblGenomes | N/A | IEA |
GO:0015116 | GO-mf | sulfate transmembrane transporter activity | EnsemblGenomes | N/A | IEA |
GO:0015117 | GO-mf | thiosulfate transmembrane transporter activity | EnsemblGenomes | N/A | IEA |
GO:0015131 | GO-mf | oxaloacetate transmembrane transporter activity | EnsemblGenomes | N/A | IEA |
GO:0015140 | GO-mf | malate transmembrane transporter activity | EnsemblGenomes | N/A | IEA |
GO:0015141 | GO-mf | succinate transmembrane transporter activity | EnsemblGenomes | N/A | IEA |
GO:0015297 | GO-mf | antiporter activity | EnsemblGenomes | N/A | IEA |
PTHR24089 | Panther | FAMILY NOT NAMED | JGI | N/A | IEA |
PTHR24089:SF78 | Panther | JGI | N/A | IEA | |
PF00153 | PFAM | Mitochondrial carrier protein | JGI | N/A | IEA |
Glyma.06g093900 not represented in the dataset |
Glyma.06g093900 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma06g09850 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.06g093900.1 sequence-type=CDS polypeptide=Glyma.06g093900.1.p locus=Glyma.06g093900 ID=Glyma.06g093900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAGTAACCAAGAGGTCGTTGGTAGCCTGTGGCGCGGTTCAGTGCTTACGGTGAACCGCGCGATGATCGTTACGGCTTCTCAGTTAGCCTCGTACGACCAGTTTAAGGAAACTATTCTGGGACGCGGTTTGATGGAGGACGGGCTGGGGACCCACGTGGCAGCGAGTTTTGCGGCGGGTTTTGTGGCGTCCGTTGCGTCGAACCCCATTGATGTTATAAAGACTAGGGTGATGAACATGAATGCTGAGGCTTACAATGGAGCCTTGGATTGTGCTCTCAAGACTGTTAGGGCTGAAGGACCTCTTGCCCTTTATAAAGGTTTCATCCCTACAATTTCAAGACAGGGTCCTTTCACCGTCGTCCTCTTTGTCACCCTTGAACAAGTCAGGAAGCTGCTTAAGGATTTTTGA
>Glyma.06g093900.1.p sequence-type=predicted peptide transcript=Glyma.06g093900.1 locus=Glyma.06g093900 ID=Glyma.06g093900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MSNQEVVGSLWRGSVLTVNRAMIVTASQLASYDQFKETILGRGLMEDGLGTHVAASFAAGFVASVASNPIDVIKTRVMNMNAEAYNGALDCALKTVRAEGPLALYKGFIPTISRQGPFTVVLFVTLEQVRKLLKDF*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||