Glyma.06G319400

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.06G319400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.06G319400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.06G319400

Feature Type:	gene_model
Chromosome:	Gm06
Start:	50825005
stop:	50826229
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.06G319400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
GO:0005975	GO-bp	carbohydrate metabolic process	EnsemblGenomes	N/A	IEA
GO:0007015	GO-bp	actin filament organization	EnsemblGenomes	N/A	IEA
GO:0008152	GO-bp	metabolic process	EnsemblGenomes	N/A	IEA
GO:0004553	GO-mf	hydrolase activity, hydrolyzing O-glycosyl compounds	EnsemblGenomes	N/A	IEA
GO:0016787	GO-mf	hydrolase activity	EnsemblGenomes	N/A	IEA
GO:0016798	GO-mf	hydrolase activity, acting on glycosyl bonds	EnsemblGenomes	N/A	IEA
GO:0051015	GO-mf	actin filament binding	EnsemblGenomes	N/A	IEA
PTHR10551	Panther	FASCIN	JGI	N/A	IEA
PTHR10551:SF6	Panther		JGI	N/A	IEA
PF00150	PFAM	Cellulase (glycosyl hydrolase family 5)	JGI	N/A	IEA
GN7V-65202	SoyCyc9-rxn	glucan 1,3-β-glucosidase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.06G319400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.06G319400 not represented in the dataset	Glyma.06G319400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.06G319400 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g319400	Wm82.a4.v1	ISS	As supplied by JGI

Coding sequences of Glyma.06G319400

Limit To All Plant Sequences

>Glyma.06g319400.1 sequence-type=CDS polypeptide=Glyma.06g319400.1.p locus=Glyma.06g319400 ID=Glyma.06g319400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAATGAGCCAAAAGGTGTGAATCTAGACATCCTTAAGAAGTATTACAAAGAAGCTTATGATGCTGTGAGGAAGCACAGCTCAAGTGCTTATGCGATCATGTCAAATCCATTGGATGCAGATTCTAAAGTGATTCTCTCATTTGTGAAAGGCTTTGACAGAGTAGTCATTGATGTGCATTACTACAATCTTTATTCCTGCAAATTCAACAACATGAATGCTCAACAAAATATTGACTTCATAAGAGAGGATCCTCAAATGCTGAGTTTTGTAGGGTAG

Predicted protein sequences of Glyma.06G319400

Limit To All Plant Sequences

>Glyma.06g319400.1.p sequence-type=predicted peptide transcript=Glyma.06g319400.1 locus=Glyma.06g319400 ID=Glyma.06g319400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MNEPKGVNLDILKKYYKEAYDAVRKHSSSAYAIMSNPLDADSKVILSFVKGFDRVVIDVHYYNLYSCKFNNMNAQQNIDFIREDPQMLSFVG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain