SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.06G307200

Feature Type:gene_model
Chromosome:Gm06
Start:49609833
stop:49613825
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G42570.1AT B-cell receptor-associated 31-like JGI N/AIEA
GO:0006886GO-bp intracellular protein transport EnsemblGenomesN/AIEA
GO:0006886GO-bp intracellular protein transport JGI N/AIEA
GO:0006888GO-bp ER to Golgi vesicle-mediated transport EnsemblGenomesN/AIEA
GO:0070973GO-bp protein localization to endoplasmic reticulum exit site EnsemblGenomesN/AIEA
GO:0005783GO-cc endoplasmic reticulum EnsemblGenomesN/AIEA
GO:0005783GO-cc endoplasmic reticulum JGI N/AIEA
GO:0005789GO-cc endoplasmic reticulum membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane JGI N/AIEA
KOG1962 KOG B-cell receptor-associated protein and related proteins JGI N/AIEA
PTHR12701Panther BCR-ASSOCIATED PROTEIN, BAP JGI N/AIEA
PTHR12701:SF1Panther JGI N/AIEA
PF05529PFAM B-cell receptor-associated protein 31-like JGI N/AIEA

LocusGene SymbolProtein Name
bZIP56 Basic leucine zipper transcription factor-like protein gene 56

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.12g097500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g307200 Wm82.a4.v1ISS As supplied by JGI
Glyma06g46370 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.06g307200.1 sequence-type=CDS polypeptide=Glyma.06g307200.1.p locus=Glyma.06g307200 ID=Glyma.06g307200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTGCAGCTACTCTACACTGCGATTTTCTTCGAAATGATTCTCATTCTCACCCTTGTCTTCAAGACCCCACTGAGAAAACTCGTCATCGTTTCCCTCGATCGTGTGAAGCGCGGTCGCGGCCCCGTGGTGGTTTCCACCGTGGGCGCCACATTGGTGGTGGTTCTCGCGTCGAGCCTCTACAGCATGGCCAAGATCCAGCAACGCACCCTCGAGGCCGGCATAGTCAACCCCACCGACCAAGTCCTCATGTCCAAGCACATGCTCGAGGCTTCTCTCATGGGGTTTGTACTGTTCCTCTCTCTGATGATTGATAGACTGCACCATTACATAAGAGAGCTTCGGTCACTCAGGAAGACCATGGAAGCCATTAAGAAACAAAGCCGAAGTTTTGAAGATGGTAAAAATGGCAATTTAGAGGAACATAAAGCATTGAATGAAGAAATTACCACATTGAAGTCTAAAATTAAGAAACTAGAATCTGAATGTGAGGCAAAAGGAAATCAAGCTAAGACTTTGGAAACTGAAGTAGAGGCTCTTAAAAAGCAATCCGAAGGGTTCCTTATGGAATATGATCGCCTCTTGGAAGACAATCAGAGTCTTAGGAGTCAGTTGCAGGCCATTGAGCAGAACCCTTTGTAA

>Glyma.06g307200.1.p sequence-type=predicted peptide transcript=Glyma.06g307200.1 locus=Glyma.06g307200 ID=Glyma.06g307200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLQLLYTAIFFEMILILTLVFKTPLRKLVIVSLDRVKRGRGPVVVSTVGATLVVVLASSLYSMAKIQQRTLEAGIVNPTDQVLMSKHMLEASLMGFVLFLSLMIDRLHHYIRELRSLRKTMEAIKKQSRSFEDGKNGNLEEHKALNEEITTLKSKIKKLESECEAKGNQAKTLETEVEALKKQSEGFLMEYDRLLEDNQSLRSQLQAIEQNPL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo