|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G46370.4 | AT | Auxin-responsive GH3 family protein | JGI | N/A | IEA |
| GO:0009611 | GO-bp | response to wounding | EnsemblGenomes | N/A | IEA |
| GO:0009694 | GO-bp | jasmonic acid metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0009864 | GO-bp | induced systemic resistance, jasmonic acid mediated signaling pathway | EnsemblGenomes | N/A | IEA |
| GO:0080123 | GO-mf | jasmonate-amino synthetase activity | EnsemblGenomes | N/A | IEA |
| PF03321 | PFAM | GH3 auxin-responsive promoter | JGI | N/A | IEA |
| PWY-6220 | SoyCyc9 | jasmonoyl-amino acid conjugates biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-6233 | SoyCyc9 | jasmonoyl-amino acid conjugates biosynthesis II | Plant Metabolic Network | ISS | |
| PWY-6234 | SoyCyc9 | superpathway of jasmonoyl-amino acid conjugates biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-63286 | SoyCyc9-rxn | Enzyme name not determined | Plant Metabolic Network | ISS |
|
Glyma.06G243500 not represented in the dataset |
Glyma.06G243500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g243500 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma06g37401 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.06g243500.1 sequence-type=CDS polypeptide=Glyma.06g243500.1.p locus=Glyma.06g243500 ID=Glyma.06g243500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCAAGAAAGAGTTCAGAGGGAAACACTCAAGAGGATTTTGGAGGATAACGCATCAGCAGAGTACTTGCAGAGTTTGGGTCTCAATGGAAGAACTGACCCTGAGAGTTTCAAGGCCTGTGTTCCAATGGTCACCCACAAAGAATTGGAACCTTATATCTACAGAATTATTGATGGTGATGCTTCTCCTATTCTCACTGGAAAACCCATCACAACCATGTCCTTAAGTTCTGGCACTACCCAGGGGAAACCAAAGTATGTACCTTGGAATGATGAATTGTATGAAACCACAATGCAGATATACCAGACCTCTTTTGCCTTTAGAAACAGGGAGTTTCCTATAATGTTGTGGTGA
>Glyma.06g243500.1.p sequence-type=predicted peptide transcript=Glyma.06g243500.1 locus=Glyma.06g243500 ID=Glyma.06g243500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MQERVQRETLKRILEDNASAEYLQSLGLNGRTDPESFKACVPMVTHKELEPYIYRIIDGDASPILTGKPITTMSLSSGTTQGKPKYVPWNDELYETTMQIYQTSFAFRNREFPIMLW*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||