|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G56630.1 | AT | phosphofructokinase 7 | JGI | N/A | IEA |
| GLYCOLYSIS | SoyCyc9 | glycolysis I (from glucose 6-phosphate) | Plant Metabolic Network | ISS | |
| PWY-1042 | SoyCyc9 | glycolysis IV (plant cytosol) | Plant Metabolic Network | ISS | |
| PWY-5464 | SoyCyc9 | superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle | Plant Metabolic Network | ISS | |
| PWY-5484 | SoyCyc9 | glycolysis II (from fructose 6-phosphate) | Plant Metabolic Network | ISS | |
| PWY-7345 | SoyCyc9 | superpathway of anaerobic sucrose degradation | Plant Metabolic Network | ISS | |
| GN7V-65207 | SoyCyc9-rxn | 6-phosphofructokinase | Plant Metabolic Network | ISS |
|
Glyma.06G243200 not represented in the dataset |
Glyma.06G243200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma06g37340 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.06g243200.1 sequence-type=CDS polypeptide=Glyma.06g243200.1.p locus=Glyma.06g243200 ID=Glyma.06g243200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTTTGCACTGCAGAACTTATTGTGCTGCAAATTCGTTGCCCTGCTTGATATTGTTGGTTCTGCTTCTCCAACATAGATATGATTTATTTGTTAAGAATAGAATCACTCAGGGACAGAACAAAGTGCTAATTACTGATAGAATGTGGGCTAGGCTTCTATCTTCAACAAATCTGCCCAGCTTTACGATTGCTAAGACTGTCTCTGAAGAAAAAAGGGAAGAAGAAGCAAACGGTAATGTCCCTGAGTAA
>Glyma.06g243200.1.p sequence-type=predicted peptide transcript=Glyma.06g243200.1 locus=Glyma.06g243200 ID=Glyma.06g243200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MALHCRTYCAANSLPCLILLVLLLQHRYDLFVKNRITQGQNKVLITDRMWARLLSSTNLPSFTIAKTVSEEKREEEANGNVPE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||