|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G52560.1 | AT | UDP-sugar pyrophosphorylase | JGI | N/A | IEA |
| GO:0009226 | GO-bp | nucleotide-sugar biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0005829 | GO-cc | cytosol | EnsemblGenomes | N/A | IEA |
| GO:0070569 | GO-mf | uridylyltransferase activity | EnsemblGenomes | N/A | IEA |
| PTHR11952 | Panther | UDP- GLUCOSE PYROPHOSPHORYLASE | JGI | N/A | IEA |
| PTHR11952:SF2 | Panther | LD24639P | JGI | N/A | IEA |
| PWY-3801 | SoyCyc9 | sucrose degradation II (sucrose synthase) | Plant Metabolic Network | ISS | |
| PWY-3821 | SoyCyc9 | D-galactose detoxification | Plant Metabolic Network | ISS | |
| PWY-4841 | SoyCyc9 | UDP-α-D-glucuronate biosynthesis (from myo-inositol) | Plant Metabolic Network | ISS | |
| PWY-6527 | SoyCyc9 | stachyose degradation | Plant Metabolic Network | ISS | |
| PWY-7238 | SoyCyc9 | sucrose biosynthesis II | Plant Metabolic Network | ISS | |
| PWY-7343 | SoyCyc9 | UDP-α-D-glucose biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-7345 | SoyCyc9 | superpathway of anaerobic sucrose degradation | Plant Metabolic Network | ISS | |
| PWYQT-4466 | SoyCyc9 | superpathway of sucrose and starch metabolism I (non-photosynthetic tissue) | Plant Metabolic Network | ISS | |
| SUCSYN-PWY | SoyCyc9 | sucrose biosynthesis I (from photosynthesis) | Plant Metabolic Network | ISS | |
| UDPNACETYLGALSYN-PWY | SoyCyc9 | UDP-N-acetyl-D-glucosamine biosynthesis II | Plant Metabolic Network | ISS | |
| GN7V-56778 | SoyCyc9-rxn | glucuronate-1-phosphate uridylyltransferase | Plant Metabolic Network | ISS |
|
Glyma.06G242400 not represented in the dataset |
Glyma.06G242400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma06g37151 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.06g242400.1 sequence-type=CDS polypeptide=Glyma.06g242400.1.p locus=Glyma.06g242400 ID=Glyma.06g242400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTTCCTCCCTCGACGACAACTTCAACCTTCTCTCTCCTGAACAGCAAGAGCTGGTGAAGGTGCTACTGGATAACGGCCAAGAGCACCTGTTTCGCGATTGGCCAGCTCCCGGCGTCGATGATAACCACAAGAAAGCGTTCTTTGACCAGTTGACTCAACTCGATTCGAGTTACCCTGGTGGTCTGGAATCATACATCAAAAACGCTAAACGGCTCTTGGCCGATTCTAAGGCTGGCATAAACCCTTTCGACGGCTTTACACCTTCCGTTCCAACGGGTGAGACTTTGGCATTTGGTGATGAGAGCTACATCAAATTTGAGGAAGCAGGTGTACTTGAAGCTCGACTGCTTTTGTTCTTGTTGCCGGTGGTCTTGGCAAGCGTTTAG
>Glyma.06g242400.1.p sequence-type=predicted peptide transcript=Glyma.06g242400.1 locus=Glyma.06g242400 ID=Glyma.06g242400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MASSLDDNFNLLSPEQQELVKVLLDNGQEHLFRDWPAPGVDDNHKKAFFDQLTQLDSSYPGGLESYIKNAKRLLADSKAGINPFDGFTPSVPTGETLAFGDESYIKFEEAGVLEARLLLFLLPVVLASV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||