|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G32830.1 | AT | ataurora1 | JGI | N/A | IEA |
| GO:0006468 | GO-bp | protein phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0006468 | GO-bp | protein phosphorylation | JGI | N/A | IEA |
| GO:0007049 | GO-bp | cell cycle | EnsemblGenomes | N/A | IEA |
| GO:0007052 | GO-bp | mitotic spindle organization | EnsemblGenomes | N/A | IEA |
| GO:0032465 | GO-bp | regulation of cytokinesis | EnsemblGenomes | N/A | IEA |
| GO:0035404 | GO-bp | histone-serine phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0000780 | GO-cc | condensed nuclear chromosome, centromeric region | EnsemblGenomes | N/A | IEA |
| GO:0005876 | GO-cc | spindle microtubule | EnsemblGenomes | N/A | IEA |
| GO:0032133 | GO-cc | chromosome passenger complex | EnsemblGenomes | N/A | IEA |
| GO:0051233 | GO-cc | spindle midzone | EnsemblGenomes | N/A | IEA |
| GO:0004672 | GO-mf | protein kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0004672 | GO-mf | protein kinase activity | JGI | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | JGI | N/A | IEA |
| GO:0035174 | GO-mf | histone serine kinase activity | EnsemblGenomes | N/A | IEA |
| PTHR24350 | Panther | SERINE/THREONINE-PROTEIN KINASE IAL-RELATED | JGI | N/A | IEA |
| PF00069 | PFAM | Protein kinase domain | JGI | N/A | IEA |
|
Glyma.06G088700 not represented in the dataset |
Glyma.06G088700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g088700 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma06g09345 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.06g088700.1 sequence-type=CDS polypeptide=Glyma.06g088700.1.p locus=Glyma.06g088700 ID=Glyma.06g088700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCCATCGCAACAGAGACTCAACCTCAACTCCAACACCACACGACTAGTCACATTGTTGCTTTGAAAGTACTCTTTAAGTGCCAATTGCAACAATCCCAAGTCGTGCATCAACTTCAACGTGAAGTTGAAATACAAAGTCATCTCCGACATCCCCACATCTTGCGCCTTTATGGATACTTTTATGATCAGAAACGAATTTATTTGATTTTAGAGTATGCACCCAAAGGTGAACTTTACAACGGAGTTGCAGAAATGCAAATATTTCAGTGA
>Glyma.06g088700.1.p sequence-type=predicted peptide transcript=Glyma.06g088700.1 locus=Glyma.06g088700 ID=Glyma.06g088700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAIATETQPQLQHHTTSHIVALKVLFKCQLQQSQVVHQLQREVEIQSHLRHPHILRLYGYFYDQKRIYLILEYAPKGELYNGVAEMQIFQ*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||