SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.06G010200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.06G010200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.06G010200

Feature Type:gene_model
Chromosome:Gm06
Start:800970
stop:802207
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34590.1AT G-box binding factor 6 JGI N/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0003700GO-mf DNA binding transcription factor activity EnsemblGenomesN/AIEA
GO:0003700GO-mf sequence-specific DNA binding transcription factor activity JGI N/AIEA
GO:0043565GO-mf sequence-specific DNA binding JGI N/AIEA
PTHR22952Panther CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED JGI N/AIEA
PTHR22952:SF60Panther JGI N/AIEA
PF07716PFAM Basic region leucine zipper JGI N/AIEA

LocusGene SymbolProtein Name
bZIP47 Basic leucine zipper transcription factor-like protein gene 47
bZIP123 homeobox-leucine zipper protein

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.06G010200 not represented in the dataset

Glyma.06G010200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.04g010300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g010200 Wm82.a4.v1ISS As supplied by JGI
Glyma06g01240 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.06g010200.1 sequence-type=CDS polypeptide=Glyma.06g010200.1.p locus=Glyma.06g010200 ID=Glyma.06g010200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGACTATGGCTTGTTCAAGTGGAACATCTTCAGGGACGTCGTCGGAGCTGCAGGGTATGATGGATCAGAGGAAGAGGAAGAGAATGATATCGAACCGCGAATCGGCAAGGCGATCTCGAATGAGGAAGCAGAAGCACTTGGATGATCTAGCATCGCAGCTGACTCAGCTCAGGAGCCAGAATCAGCAGCTTCTCACGTCTGTGAACCTCACCAGCCACAAGTACTTGGCGGTGGAGGCTGAGAACTCTGTTTTGAGAGCACAAGTGAACGAGCTCAGCCACAGGTTGGACTCTCTCAACCAGATCATCCACTTGTTGAATTTCTTTGAGCCCGATGCTAGTACTAGTACCTTCTTCAACAACCCTTTCAATTTCAGCCTCCCGATTATGGCTTCAGCAGACATGTTGCAGTACTGA

>Glyma.06g010200.1.p sequence-type=predicted peptide transcript=Glyma.06g010200.1 locus=Glyma.06g010200 ID=Glyma.06g010200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MTMACSSGTSSGTSSELQGMMDQRKRKRMISNRESARRSRMRKQKHLDDLASQLTQLRSQNQQLLTSVNLTSHKYLAVEAENSVLRAQVNELSHRLDSLNQIIHLLNFFEPDASTSTFFNNPFNFSLPIMASADMLQY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo