Report for Sequence Feature Glyma.05g248200
Feature Type: gene_model
Chromosome: Gm05
Start: 42124919
stop: 42125764
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.05g248200
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G75240.1 AT
homeobox protein 33
JGI N/A IEA
GO:0003677 GO-mf
DNA binding
EnsemblGenomes N/A IEA
PF04770 PFAM
ZF-HD protein dimerisation region
JGI N/A IEA
Expression Patterns of Glyma.05g248200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.05g248200
Paralog Evidence Comments
Glyma.08g056700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.05g248200 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma05g33600 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.05g248200
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.05g248200.1 sequence-type=CDS polypeptide=Glyma.05g248200.1.p locus=Glyma.05g248200 ID=Glyma.05g248200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAAGGAGGATCAGGTGGCGAGAGGAACAGTAGTGTATACCGAGAGTGCTTGAGAAATCATGCAGCCAGCCTAGGAAGCTACGCCACGGACGGGTGCGGCGAGTACACGGTGGACGGCGCGGGGGGACTACAATGCGCCGCGTGCGGGTGCCACCGCAACTTCCACCGGAAAGTGAAGTACCTGGCGGCGGCTGAAAGCCCTCCCACGGAGTATGGGGGCAGCAACAGCAAGAAGCGGTTCAGGTCTAAGTTCACGGAAGATCAAAAGGAGAAGATGCTAGGGTTTGCGGAGAAGCTTGGTTGGAAGCTTCAGAGGAGGGATCTTGATGATGAGATAGAGAGGTTTTGCCGAAGCGTTGGGGTGAGTAGGCAAGTCTTCAAAGTTTGGATGCATAACCATAAGAACTCTTCCTCCTCCTCTTCTACCGCCGCCAATGTCTCCTCCCTCACCCAGTAA
Predicted protein sequences of Glyma.05g248200
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.05g248200.1.p sequence-type=predicted peptide transcript=Glyma.05g248200.1 locus=Glyma.05g248200 ID=Glyma.05g248200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEGGSGGERNSSVYRECLRNHAASLGSYATDGCGEYTVDGAGGLQCAACGCHRNFHRKVKYLAAAESPPTEYGGSNSKKRFRSKFTEDQKEKMLGFAEKLGWKLQRRDLDDEIERFCRSVGVSRQVFKVWMHNHKNSSSSSSTAANVSSLTQ*